Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2106090..2106667 | Replicon | chromosome |
Accession | NZ_CP097327 | ||
Organism | Providencia vermicola strain P13 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U5N651 |
Locus tag | M5J11_RS09590 | Protein ID | WP_023159957.1 |
Coordinates | 2106335..2106667 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M5J11_RS09585 | Protein ID | WP_096864992.1 |
Coordinates | 2106090..2106335 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J11_RS09555 (M5J11_09555) | 2101264..2102301 | + | 1038 | Protein_1835 | IS630-like element ISAeme16 family transposase | - |
M5J11_RS09570 (M5J11_09570) | 2104462..2104755 | + | 294 | WP_101135438.1 | hypothetical protein | - |
M5J11_RS09575 (M5J11_09575) | 2104853..2105080 | - | 228 | WP_096864993.1 | plasmid partition protein ParG | - |
M5J11_RS09580 (M5J11_09580) | 2105197..2105820 | - | 624 | WP_023159958.1 | AAA family ATPase | - |
M5J11_RS09585 (M5J11_09585) | 2106090..2106335 | + | 246 | WP_096864992.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M5J11_RS09590 (M5J11_09590) | 2106335..2106667 | + | 333 | WP_023159957.1 | endoribonuclease MazF | Toxin |
M5J11_RS09595 (M5J11_09595) | 2106698..2107078 | + | 381 | WP_096864991.1 | hypothetical protein | - |
M5J11_RS09600 (M5J11_09600) | 2107164..2107307 | - | 144 | WP_071547955.1 | Hok/Gef family protein | - |
M5J11_RS09610 (M5J11_09610) | 2108013..2109181 | + | 1169 | WP_166685554.1 | IS3 family transposase | - |
M5J11_RS09615 (M5J11_09615) | 2109188..2109520 | + | 333 | Protein_1845 | glycosyltransferase | - |
M5J11_RS09620 (M5J11_09620) | 2109601..2110767 | + | 1167 | WP_251465220.1 | nucleotide sugar dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | ugd / ugd | 2074594..2124332 | 49738 | |
- | inside | IScluster/Tn | - | ugd | 2097885..2109181 | 11296 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12097.88 Da Isoelectric Point: 7.0813
>T245158 WP_023159957.1 NZ_CP097327:2106335-2106667 [Providencia vermicola]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|