Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1946903..1947553 | Replicon | chromosome |
Accession | NZ_CP097327 | ||
Organism | Providencia vermicola strain P13 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | K8W3H1 |
Locus tag | M5J11_RS08915 | Protein ID | WP_004927064.1 |
Coordinates | 1946903..1947106 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | M5J11_RS08920 | Protein ID | WP_154635730.1 |
Coordinates | 1947185..1947553 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J11_RS08890 (M5J11_08890) | 1942783..1943121 | + | 339 | WP_154622397.1 | P-II family nitrogen regulator | - |
M5J11_RS08895 (M5J11_08895) | 1943132..1944415 | + | 1284 | WP_251465118.1 | ammonium transporter AmtB | - |
M5J11_RS08900 (M5J11_08900) | 1944643..1945509 | - | 867 | WP_251465121.1 | acyl-CoA thioesterase II | - |
M5J11_RS08905 (M5J11_08905) | 1945834..1946292 | + | 459 | WP_251465123.1 | YbaY family lipoprotein | - |
M5J11_RS08915 (M5J11_08915) | 1946903..1947106 | - | 204 | WP_004927064.1 | HHA domain-containing protein | Toxin |
M5J11_RS08920 (M5J11_08920) | 1947185..1947553 | - | 369 | WP_154635730.1 | Hha toxicity modulator TomB | Antitoxin |
M5J11_RS08925 (M5J11_08925) | 1948121..1949458 | - | 1338 | WP_154624041.1 | murein transglycosylase D | - |
M5J11_RS08930 (M5J11_08930) | 1949537..1950292 | - | 756 | WP_154624042.1 | hydroxyacylglutathione hydrolase | - |
M5J11_RS08935 (M5J11_08935) | 1950332..1951057 | + | 726 | WP_154624043.1 | methyltransferase domain-containing protein | - |
M5J11_RS08940 (M5J11_08940) | 1951124..1951594 | - | 471 | WP_154624044.1 | ribonuclease HI | - |
M5J11_RS08945 (M5J11_08945) | 1951649..1952410 | + | 762 | WP_154624045.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8075.37 Da Isoelectric Point: 6.9770
>T245157 WP_004927064.1 NZ_CP097327:c1947106-1946903 [Providencia vermicola]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14106.92 Da Isoelectric Point: 4.3486
>AT245157 WP_154635730.1 NZ_CP097327:c1947553-1947185 [Providencia vermicola]
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|