Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1281844..1282761 | Replicon | chromosome |
Accession | NZ_CP097326 | ||
Organism | Bacillus velezensis strain GUCC45 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | M5J22_RS06645 | Protein ID | WP_003154806.1 |
Coordinates | 1282015..1282761 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | M5J22_RS06640 | Protein ID | WP_060386896.1 |
Coordinates | 1281844..1282014 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J22_RS06600 (M5J22_06600) | 1277056..1278645 | + | 1590 | WP_029973066.1 | hypothetical protein | - |
M5J22_RS06605 (M5J22_06605) | 1278658..1279083 | + | 426 | WP_029973065.1 | hypothetical protein | - |
M5J22_RS06610 (M5J22_06610) | 1279088..1279285 | + | 198 | WP_007610833.1 | XkdX family protein | - |
M5J22_RS06615 (M5J22_06615) | 1279342..1280103 | + | 762 | WP_024085194.1 | hypothetical protein | - |
M5J22_RS06620 (M5J22_06620) | 1280155..1280418 | + | 264 | WP_032866112.1 | hemolysin XhlA family protein | - |
M5J22_RS06625 (M5J22_06625) | 1280432..1280695 | + | 264 | WP_003154813.1 | phage holin | - |
M5J22_RS06630 (M5J22_06630) | 1280709..1281587 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
M5J22_RS06635 (M5J22_06635) | 1281622..1281747 | - | 126 | WP_003154809.1 | hypothetical protein | - |
M5J22_RS06640 (M5J22_06640) | 1281844..1282014 | - | 171 | WP_060386896.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M5J22_RS06645 (M5J22_06645) | 1282015..1282761 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M5J22_RS06650 (M5J22_06650) | 1282866..1283864 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
M5J22_RS06655 (M5J22_06655) | 1283877..1284494 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
M5J22_RS06660 (M5J22_06660) | 1284780..1286096 | - | 1317 | WP_046559522.1 | amino acid permease | - |
M5J22_RS06665 (M5J22_06665) | 1286420..1287370 | + | 951 | WP_060386897.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1247473..1340003 | 92530 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T245154 WP_003154806.1 NZ_CP097326:c1282761-1282015 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|