Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 508756..509393 | Replicon | chromosome |
Accession | NZ_CP097326 | ||
Organism | Bacillus velezensis strain GUCC45 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M5J22_RS02455 | Protein ID | WP_003156187.1 |
Coordinates | 509043..509393 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M5J22_RS02450 | Protein ID | WP_003156188.1 |
Coordinates | 508756..509037 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J22_RS02430 (M5J22_02430) | 505121..505720 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
M5J22_RS02435 (M5J22_02435) | 505813..506178 | + | 366 | WP_003156192.1 | holo-ACP synthase | - |
M5J22_RS02440 (M5J22_02440) | 506343..507350 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
M5J22_RS02445 (M5J22_02445) | 507467..508636 | + | 1170 | WP_003156189.1 | alanine racemase | - |
M5J22_RS02450 (M5J22_02450) | 508756..509037 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M5J22_RS02455 (M5J22_02455) | 509043..509393 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M5J22_RS02460 (M5J22_02460) | 509511..510332 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M5J22_RS02465 (M5J22_02465) | 510337..510702 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M5J22_RS02470 (M5J22_02470) | 510705..511106 | + | 402 | WP_201488789.1 | anti-sigma regulatory factor | - |
M5J22_RS02475 (M5J22_02475) | 511118..512125 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
M5J22_RS02480 (M5J22_02480) | 512189..512518 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M5J22_RS02485 (M5J22_02485) | 512515..512997 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
M5J22_RS02490 (M5J22_02490) | 512963..513751 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M5J22_RS02495 (M5J22_02495) | 513751..514353 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245153 WP_003156187.1 NZ_CP097326:509043-509393 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|