Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4862341..4862957 Replicon chromosome
Accession NZ_CP097324
Organism Citrobacter sp. XT1-2-2 strain XT1_2_2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M4I31_RS23150 Protein ID WP_085049711.1
Coordinates 4862341..4862715 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag M4I31_RS23155 Protein ID WP_001523745.1
Coordinates 4862715..4862957 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I31_RS23135 (4859844) 4859844..4860746 + 903 WP_003028691.1 formate dehydrogenase O subunit beta -
M4I31_RS23140 (4860743) 4860743..4861378 + 636 WP_038635897.1 formate dehydrogenase cytochrome b556 subunit -
M4I31_RS23145 (4861375) 4861375..4862304 + 930 WP_006686145.1 formate dehydrogenase accessory protein FdhE -
M4I31_RS23150 (4862341) 4862341..4862715 - 375 WP_085049711.1 type II toxin-antitoxin system VapC family toxin Toxin
M4I31_RS23155 (4862715) 4862715..4862957 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
M4I31_RS23160 (4863161) 4863161..4864069 + 909 WP_085049710.1 alpha/beta hydrolase -
M4I31_RS23165 (4864134) 4864134..4864376 + 243 WP_069324888.1 type II toxin-antitoxin system ParD family antitoxin -
M4I31_RS23170 (4864369) 4864369..4864656 + 288 WP_085049709.1 type II toxin-antitoxin system RelE/ParE family toxin -
M4I31_RS23175 (4864662) 4864662..4865603 - 942 WP_032940213.1 fatty acid biosynthesis protein FabY -
M4I31_RS23180 (4865648) 4865648..4866085 - 438 WP_003825289.1 D-aminoacyl-tRNA deacylase -
M4I31_RS23185 (4866082) 4866082..4866954 - 873 WP_085049708.1 virulence factor BrkB family protein -
M4I31_RS23190 (4866948) 4866948..4867547 - 600 WP_069324890.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13697.93 Da        Isoelectric Point: 8.5343

>T245152 WP_085049711.1 NZ_CP097324:c4862715-4862341 [Citrobacter sp. XT1-2-2]
MVKGAALFDTNILIDLFSGRSEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRIALGAFNIIGVSQDIAERSVNI
RQEYGMKLPDAIILATAQIHHLTLVTRNTKDFASISGVVTPYTL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT245152 WP_001523745.1 NZ_CP097324:c4862957-4862715 [Citrobacter sp. XT1-2-2]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References