Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 4589015..4589550 | Replicon | chromosome |
| Accession | NZ_CP097324 | ||
| Organism | Citrobacter sp. XT1-2-2 strain XT1_2_2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M4I31_RS21820 | Protein ID | WP_085049650.1 |
| Coordinates | 4589263..4589550 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D4BKM9 |
| Locus tag | M4I31_RS21815 | Protein ID | WP_006688247.1 |
| Coordinates | 4589015..4589266 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I31_RS21785 (4584508) | 4584508..4585266 | + | 759 | WP_085049653.1 | phosphonate C-P lyase system protein PhnK | - |
| M4I31_RS21790 (4585374) | 4585374..4586054 | + | 681 | WP_069325130.1 | phosphonate C-P lyase system protein PhnL | - |
| M4I31_RS21795 (4586051) | 4586051..4587187 | + | 1137 | WP_085049652.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
| M4I31_RS21800 (4587190) | 4587190..4587744 | + | 555 | WP_038636371.1 | ribose 1,5-bisphosphokinase | - |
| M4I31_RS21805 (4587731) | 4587731..4588165 | + | 435 | WP_038636367.1 | aminoalkylphosphonate N-acetyltransferase | - |
| M4I31_RS21810 (4588174) | 4588174..4588932 | + | 759 | WP_085049651.1 | phosphonate metabolism protein PhnP | - |
| M4I31_RS21815 (4589015) | 4589015..4589266 | + | 252 | WP_006688247.1 | plasmid stabilization protein | Antitoxin |
| M4I31_RS21820 (4589263) | 4589263..4589550 | + | 288 | WP_085049650.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4I31_RS21825 (4589547) | 4589547..4589876 | - | 330 | WP_069325126.1 | DDRRRQL repeat protein YjdP | - |
| M4I31_RS21830 (4589946) | 4589946..4592210 | - | 2265 | WP_085049649.1 | hybrid sensor histidine kinase/response regulator | - |
| M4I31_RS21835 (4592325) | 4592325..4593848 | + | 1524 | WP_069325124.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11089.04 Da Isoelectric Point: 10.3527
>T245151 WP_085049650.1 NZ_CP097324:4589263-4589550 [Citrobacter sp. XT1-2-2]
MSYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
MSYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCENPHVPSAKLRGIKDCYKIKLRTSGFRLVYQVIDDTLVIAVVAVGK
RERSEVYNLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|