Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3676761..3677381 | Replicon | chromosome |
| Accession | NZ_CP097324 | ||
| Organism | Citrobacter sp. XT1-2-2 strain XT1_2_2 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M4I31_RS17585 | Protein ID | WP_002892050.1 |
| Coordinates | 3677163..3677381 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | M4I31_RS17580 | Protein ID | WP_003021733.1 |
| Coordinates | 3676761..3677135 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I31_RS17570 (3671908) | 3671908..3673101 | + | 1194 | WP_038638348.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M4I31_RS17575 (3673124) | 3673124..3676273 | + | 3150 | WP_038638345.1 | efflux RND transporter permease AcrB | - |
| M4I31_RS17580 (3676761) | 3676761..3677135 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| M4I31_RS17585 (3677163) | 3677163..3677381 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M4I31_RS17590 (3677567) | 3677567..3678118 | + | 552 | WP_085047626.1 | maltose O-acetyltransferase | - |
| M4I31_RS17595 (3678235) | 3678235..3678705 | + | 471 | WP_069323967.1 | YlaC family protein | - |
| M4I31_RS17600 (3678779) | 3678779..3678919 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| M4I31_RS17605 (3678921) | 3678921..3679181 | - | 261 | WP_038638331.1 | type B 50S ribosomal protein L31 | - |
| M4I31_RS17610 (3679370) | 3679370..3680923 | + | 1554 | WP_085047627.1 | EAL domain-containing protein | - |
| M4I31_RS17615 (3680975) | 3680975..3681328 | - | 354 | WP_085047628.1 | DUF1428 family protein | - |
| M4I31_RS17620 (3681393) | 3681393..3682022 | - | 630 | WP_069323965.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T245149 WP_002892050.1 NZ_CP097324:3677163-3677381 [Citrobacter sp. XT1-2-2]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT245149 WP_003021733.1 NZ_CP097324:3676761-3677135 [Citrobacter sp. XT1-2-2]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |