Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3676761..3677381 Replicon chromosome
Accession NZ_CP097324
Organism Citrobacter sp. XT1-2-2 strain XT1_2_2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4I31_RS17585 Protein ID WP_002892050.1
Coordinates 3677163..3677381 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID R8WZW8
Locus tag M4I31_RS17580 Protein ID WP_003021733.1
Coordinates 3676761..3677135 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I31_RS17570 (3671908) 3671908..3673101 + 1194 WP_038638348.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M4I31_RS17575 (3673124) 3673124..3676273 + 3150 WP_038638345.1 efflux RND transporter permease AcrB -
M4I31_RS17580 (3676761) 3676761..3677135 + 375 WP_003021733.1 Hha toxicity modulator TomB Antitoxin
M4I31_RS17585 (3677163) 3677163..3677381 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M4I31_RS17590 (3677567) 3677567..3678118 + 552 WP_085047626.1 maltose O-acetyltransferase -
M4I31_RS17595 (3678235) 3678235..3678705 + 471 WP_069323967.1 YlaC family protein -
M4I31_RS17600 (3678779) 3678779..3678919 - 141 WP_005125190.1 type B 50S ribosomal protein L36 -
M4I31_RS17605 (3678921) 3678921..3679181 - 261 WP_038638331.1 type B 50S ribosomal protein L31 -
M4I31_RS17610 (3679370) 3679370..3680923 + 1554 WP_085047627.1 EAL domain-containing protein -
M4I31_RS17615 (3680975) 3680975..3681328 - 354 WP_085047628.1 DUF1428 family protein -
M4I31_RS17620 (3681393) 3681393..3682022 - 630 WP_069323965.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245149 WP_002892050.1 NZ_CP097324:3677163-3677381 [Citrobacter sp. XT1-2-2]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14427.23 Da        Isoelectric Point: 5.5653

>AT245149 WP_003021733.1 NZ_CP097324:3676761-3677135 [Citrobacter sp. XT1-2-2]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB R8WZW8

References