Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2488117..2488874 | Replicon | chromosome |
| Accession | NZ_CP097324 | ||
| Organism | Citrobacter sp. XT1-2-2 strain XT1_2_2 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | M4I31_RS11790 | Protein ID | WP_085048216.1 |
| Coordinates | 2488392..2488874 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A2Z3X7E0 |
| Locus tag | M4I31_RS11785 | Protein ID | WP_038640582.1 |
| Coordinates | 2488117..2488401 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I31_RS11755 (2483169) | 2483169..2483567 | - | 399 | WP_085048211.1 | ion channel | - |
| M4I31_RS11760 (2483779) | 2483779..2484417 | + | 639 | WP_085048212.1 | helix-turn-helix domain-containing protein | - |
| M4I31_RS11765 (2484579) | 2484579..2484893 | + | 315 | WP_085048213.1 | helix-turn-helix transcriptional regulator | - |
| M4I31_RS11770 (2484886) | 2484886..2486157 | + | 1272 | WP_085048214.1 | type II toxin-antitoxin system HipA family toxin | - |
| M4I31_RS11775 (2486195) | 2486195..2487562 | - | 1368 | WP_085048215.1 | glycoside hydrolase family 10 protein | - |
| M4I31_RS11780 (2487575) | 2487575..2487862 | - | 288 | WP_079224212.1 | VF530 family protein | - |
| M4I31_RS11785 (2488117) | 2488117..2488401 | + | 285 | WP_038640582.1 | DUF1778 domain-containing protein | Antitoxin |
| M4I31_RS11790 (2488392) | 2488392..2488874 | + | 483 | WP_085048216.1 | GNAT family N-acetyltransferase | Toxin |
| M4I31_RS11795 (2488897) | 2488897..2489154 | - | 258 | WP_233638873.1 | AraC family transcriptional regulator | - |
| M4I31_RS11800 (2489144) | 2489144..2489194 | - | 51 | Protein_2309 | hypothetical protein | - |
| M4I31_RS11805 (2489528) | 2489528..2490799 | - | 1272 | WP_085048217.1 | general secretion pathway protein GspD | - |
| M4I31_RS11810 (2491056) | 2491056..2491838 | - | 783 | WP_176281255.1 | zonular occludens toxin domain-containing protein | - |
| M4I31_RS11815 (2491840) | 2491840..2492178 | - | 339 | WP_085048218.1 | DUF5455 family protein | - |
| M4I31_RS11820 (2492180) | 2492180..2493172 | - | 993 | WP_085048219.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17813.50 Da Isoelectric Point: 7.7963
>T245148 WP_085048216.1 NZ_CP097324:2488392-2488874 [Citrobacter sp. XT1-2-2]
MEINVTTPVLLTEGHDLQPFDCGNDVLNDWLRRRAIKNQYLNASRTFVICLESTQRVVGYYSIATGSVSHADLGRSLRQN
MPDPVPVVLLGRLAVDVCTQGHSFGKWLLNDAVLRISNLADQVGIKAIMVHAIDGKARAFYEYFGFVQSPIAANTLFYKI
MEINVTTPVLLTEGHDLQPFDCGNDVLNDWLRRRAIKNQYLNASRTFVICLESTQRVVGYYSIATGSVSHADLGRSLRQN
MPDPVPVVLLGRLAVDVCTQGHSFGKWLLNDAVLRISNLADQVGIKAIMVHAIDGKARAFYEYFGFVQSPIAANTLFYKI
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|