Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 852378..853032 | Replicon | chromosome |
| Accession | NZ_CP097324 | ||
| Organism | Citrobacter sp. XT1-2-2 strain XT1_2_2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2Z3X2B8 |
| Locus tag | M4I31_RS04165 | Protein ID | WP_038633481.1 |
| Coordinates | 852625..853032 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | R8WMJ6 |
| Locus tag | M4I31_RS04160 | Protein ID | WP_016154349.1 |
| Coordinates | 852378..852644 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I31_RS04135 (847580) | 847580..849013 | - | 1434 | WP_038633498.1 | 6-phospho-beta-glucosidase BglA | - |
| M4I31_RS04140 (849134) | 849134..849862 | - | 729 | WP_085048762.1 | MurR/RpiR family transcriptional regulator | - |
| M4I31_RS04145 (849915) | 849915..850226 | + | 312 | WP_085048763.1 | N(4)-acetylcytidine aminohydrolase | - |
| M4I31_RS04150 (850390) | 850390..851049 | + | 660 | WP_038633489.1 | hemolysin III family protein | - |
| M4I31_RS04155 (851141) | 851141..852121 | - | 981 | WP_085048764.1 | tRNA-modifying protein YgfZ | - |
| M4I31_RS04160 (852378) | 852378..852644 | + | 267 | WP_016154349.1 | FAD assembly factor SdhE | Antitoxin |
| M4I31_RS04165 (852625) | 852625..853032 | + | 408 | WP_038633481.1 | protein YgfX | Toxin |
| M4I31_RS04170 (853133) | 853133..853654 | - | 522 | WP_038633478.1 | flavodoxin FldB | - |
| M4I31_RS04175 (853768) | 853768..854664 | + | 897 | WP_038633475.1 | site-specific tyrosine recombinase XerD | - |
| M4I31_RS04180 (854688) | 854688..855401 | + | 714 | WP_061382414.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M4I31_RS04185 (855407) | 855407..857140 | + | 1734 | WP_085048766.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15944.81 Da Isoelectric Point: 11.2845
>T245142 WP_038633481.1 NZ_CP097324:852625-853032 [Citrobacter sp. XT1-2-2]
VVQWQSDLRVSWRAQWLSLLVHGLVAVFILLMPWPLSYTPLWMVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIVSAPWMVKTGMMLRLRSDTGKRQHLWLAADSMDEAEWRDLRRLMLQQAKQG
VVQWQSDLRVSWRAQWLSLLVHGLVAVFILLMPWPLSYTPLWMVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWTIVSAPWMVKTGMMLRLRSDTGKRQHLWLAADSMDEAEWRDLRRLMLQQAKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z3X2B8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WMJ6 |