Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
| Location | 2856812..2857377 | Replicon | chromosome |
| Accession | NZ_CP097322 | ||
| Organism | Streptomyces sp. RerS4 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | M4D82_RS13150 | Protein ID | WP_249766236.1 |
| Coordinates | 2856812..2857183 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A024YMK9 |
| Locus tag | M4D82_RS13155 | Protein ID | WP_037923309.1 |
| Coordinates | 2857180..2857377 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4D82_RS13130 (M4D82_13130) | 2851846..2852643 | - | 798 | WP_249766233.1 | S16 family serine protease | - |
| M4D82_RS13135 (M4D82_13135) | 2852723..2853364 | - | 642 | WP_053684560.1 | helix-turn-helix domain-containing protein | - |
| M4D82_RS13140 (M4D82_13140) | 2853733..2854809 | + | 1077 | WP_249766234.1 | hypothetical protein | - |
| M4D82_RS13145 (M4D82_13145) | 2854889..2856676 | - | 1788 | WP_249766235.1 | DEAD/DEAH box helicase | - |
| M4D82_RS13150 (M4D82_13150) | 2856812..2857183 | - | 372 | WP_249766236.1 | Fic family protein | Toxin |
| M4D82_RS13155 (M4D82_13155) | 2857180..2857377 | - | 198 | WP_037923309.1 | Arc family DNA-binding protein | Antitoxin |
| M4D82_RS13160 (M4D82_13160) | 2857411..2858901 | - | 1491 | WP_249766237.1 | MFS transporter | - |
| M4D82_RS13165 (M4D82_13165) | 2859023..2861347 | - | 2325 | WP_249766238.1 | xanthine dehydrogenase family protein molybdopterin-binding subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13637.45 Da Isoelectric Point: 4.4983
>T245140 WP_249766236.1 NZ_CP097322:c2857183-2856812 [Streptomyces sp. RerS4]
MTHYLTLPELLNLAERLGANEVRDYGLLDSALARPQASVFGQDAYPDVWQKAAALMESLARNHGLVDGNKRIAWYATWVF
LHMNGHPLDADFDVDEAEQFVLDVCQGALDVPKIAAQLPRFAG
MTHYLTLPELLNLAERLGANEVRDYGLLDSALARPQASVFGQDAYPDVWQKAAALMESLARNHGLVDGNKRIAWYATWVF
LHMNGHPLDADFDVDEAEQFVLDVCQGALDVPKIAAQLPRFAG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|