Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3901676..3902196 | Replicon | chromosome |
Accession | NZ_CP097320 | ||
Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M5I08_RS20430 | Protein ID | WP_249762933.1 |
Coordinates | 3901912..3902196 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5I08_RS20425 | Protein ID | WP_219070811.1 |
Coordinates | 3901676..3901915 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5I08_RS20390 (M5I08_20390) | 3896927..3897451 | - | 525 | WP_219068056.1 | restriction endonuclease | - |
M5I08_RS20395 (M5I08_20395) | 3897812..3899038 | + | 1227 | WP_249763288.1 | IS110 family transposase | - |
M5I08_RS20400 (M5I08_20400) | 3899074..3899337 | - | 264 | WP_219070814.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
M5I08_RS20405 (M5I08_20405) | 3899334..3899618 | - | 285 | WP_219070813.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
M5I08_RS20410 (M5I08_20410) | 3899735..3900215 | + | 481 | Protein_4055 | peroxiredoxin | - |
M5I08_RS20415 (M5I08_20415) | 3900349..3900665 | + | 317 | Protein_4056 | DUF742 domain-containing protein | - |
M5I08_RS20420 (M5I08_20420) | 3900740..3901387 | + | 648 | WP_249763461.1 | hypothetical protein | - |
M5I08_RS20425 (M5I08_20425) | 3901676..3901915 | + | 240 | WP_219070811.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M5I08_RS20430 (M5I08_20430) | 3901912..3902196 | + | 285 | WP_249762933.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5I08_RS20435 (M5I08_20435) | 3902408..3903365 | + | 958 | Protein_4060 | transposase | - |
M5I08_RS20440 (M5I08_20440) | 3903444..3903680 | - | 237 | Protein_4061 | cytochrome P450 | - |
M5I08_RS20445 (M5I08_20445) | 3904269..3904454 | + | 186 | WP_219070903.1 | hypothetical protein | - |
M5I08_RS20450 (M5I08_20450) | 3904606..3905832 | - | 1227 | WP_249763285.1 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10585.23 Da Isoelectric Point: 11.5314
>T245138 WP_249762933.1 NZ_CP097320:3901912-3902196 [Candidatus Mycobacterium methanotrophicum]
VSSAPTDPYELRITPEGLRHLNRLPAKIRDAALAALHGPIRENPHRLGRALVGELAGLFSARRGDYRIIYSIDDTAKIVI
VHRIAHRASVYRRR
VSSAPTDPYELRITPEGLRHLNRLPAKIRDAALAALHGPIRENPHRLGRALVGELAGLFSARRGDYRIIYSIDDTAKIVI
VHRIAHRASVYRRR
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|