Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3634919..3635614 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS18915 | Protein ID | WP_219065484.1 |
| Coordinates | 3635186..3635614 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5I08_RS18910 | Protein ID | WP_219065483.1 |
| Coordinates | 3634919..3635182 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS18875 (M5I08_18875) | 3630287..3631246 | - | 960 | WP_219065481.1 | metallophosphoesterase | - |
| M5I08_RS18880 (M5I08_18880) | 3631351..3631530 | + | 180 | Protein_3746 | DUF3558 domain-containing protein | - |
| M5I08_RS18885 (M5I08_18885) | 3631658..3633235 | + | 1578 | WP_219065571.1 | CocE/NonD family hydrolase | - |
| M5I08_RS18890 (M5I08_18890) | 3633282..3633386 | + | 105 | Protein_3748 | alpha/beta hydrolase | - |
| M5I08_RS18895 (M5I08_18895) | 3633462..3634136 | - | 675 | WP_249762900.1 | DUF1802 family protein | - |
| M5I08_RS18900 (M5I08_18900) | 3634164..3634556 | - | 393 | WP_219065482.1 | PIN domain-containing protein | - |
| M5I08_RS18905 (M5I08_18905) | 3634588..3634803 | - | 216 | WP_219065573.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| M5I08_RS18910 (M5I08_18910) | 3634919..3635182 | + | 264 | WP_219065483.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5I08_RS18915 (M5I08_18915) | 3635186..3635614 | + | 429 | WP_219065484.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5I08_RS18920 (M5I08_18920) | 3635652..3635846 | - | 195 | WP_249762901.1 | hypothetical protein | - |
| M5I08_RS18925 (M5I08_18925) | 3635855..3636055 | - | 201 | WP_219065486.1 | hypothetical protein | - |
| M5I08_RS26230 | 3636376..3636498 | + | 123 | WP_255564641.1 | hypothetical protein | - |
| M5I08_RS18930 (M5I08_18930) | 3636516..3636710 | - | 195 | Protein_3757 | hypothetical protein | - |
| M5I08_RS26235 | 3636898..3638178 | + | 1281 | WP_219065487.1 | hypothetical protein | - |
| M5I08_RS18945 (M5I08_18945) | 3639054..3639212 | - | 159 | Protein_3759 | MATE family efflux transporter | - |
| M5I08_RS18950 (M5I08_18950) | 3639305..3640312 | - | 1008 | WP_219065488.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15212.12 Da Isoelectric Point: 4.8210
>T245136 WP_219065484.1 NZ_CP097320:3635186-3635614 [Candidatus Mycobacterium methanotrophicum]
VIVDSSALIALIQNEPAAEQVATVLAGARSPVISAATLTETLIVLTARRGPVARTVFDRLRTEINLGIAQYTAEHAYAAH
RAYLQFGRARHPAGLNFGDCMSYATAELAHEPLLATGNDFPQTDLEFSDGIVGYWPTPSTTD
VIVDSSALIALIQNEPAAEQVATVLAGARSPVISAATLTETLIVLTARRGPVARTVFDRLRTEINLGIAQYTAEHAYAAH
RAYLQFGRARHPAGLNFGDCMSYATAELAHEPLLATGNDFPQTDLEFSDGIVGYWPTPSTTD
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|