Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-PHD |
| Location | 3451982..3452670 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS17800 | Protein ID | WP_219068734.1 |
| Coordinates | 3451982..3452395 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5I08_RS17805 | Protein ID | WP_219068732.1 |
| Coordinates | 3452392..3452670 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS17770 (M5I08_17770) | 3447028..3447432 | - | 405 | WP_249763395.1 | MerR family transcriptional regulator | - |
| M5I08_RS17775 (M5I08_17775) | 3447591..3448172 | + | 582 | WP_249763396.1 | hypothetical protein | - |
| M5I08_RS17780 (M5I08_17780) | 3448485..3449192 | + | 708 | WP_249763397.1 | NAD-dependent deacylase | - |
| M5I08_RS17785 (M5I08_17785) | 3449335..3450315 | + | 981 | WP_249762881.1 | DNA-binding protein WhiA | - |
| M5I08_RS17790 (M5I08_17790) | 3450685..3450879 | + | 195 | WP_219068738.1 | hypothetical protein | - |
| M5I08_RS17795 (M5I08_17795) | 3451184..3451756 | + | 573 | WP_219068736.1 | Uma2 family endonuclease | - |
| M5I08_RS26205 | 3451831..3451956 | + | 126 | WP_255564734.1 | hypothetical protein | - |
| M5I08_RS17800 (M5I08_17800) | 3451982..3452395 | - | 414 | WP_219068734.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5I08_RS17805 (M5I08_17805) | 3452392..3452670 | - | 279 | WP_219068732.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5I08_RS17810 (M5I08_17810) | 3452819..3453133 | + | 315 | WP_219068746.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M5I08_RS17815 (M5I08_17815) | 3453310..3453564 | + | 255 | WP_249762882.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| M5I08_RS17820 (M5I08_17820) | 3453557..3453970 | + | 414 | WP_249762883.1 | type II toxin-antitoxin system VapC family toxin | - |
| M5I08_RS17825 (M5I08_17825) | 3454194..3454571 | + | 378 | WP_219068728.1 | hypothetical protein | - |
| M5I08_RS17830 (M5I08_17830) | 3454940..3455158 | - | 219 | WP_219068726.1 | hypothetical protein | - |
| M5I08_RS17835 (M5I08_17835) | 3455295..3455471 | - | 177 | WP_219068724.1 | hypothetical protein | - |
| M5I08_RS17840 (M5I08_17840) | 3455558..3455698 | - | 141 | WP_219068722.1 | hypothetical protein | - |
| M5I08_RS17845 (M5I08_17845) | 3455695..3455955 | - | 261 | WP_219068720.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| M5I08_RS17850 (M5I08_17850) | 3456108..3456635 | + | 528 | WP_249762884.1 | Uma2 family endonuclease | - |
| M5I08_RS17855 (M5I08_17855) | 3456731..3457015 | + | 285 | WP_219068718.1 | DUF1778 domain-containing protein | - |
| M5I08_RS17860 (M5I08_17860) | 3457012..3457317 | + | 306 | WP_219068715.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14516.70 Da Isoelectric Point: 4.3415
>T245134 WP_219068734.1 NZ_CP097320:c3452395-3451982 [Candidatus Mycobacterium methanotrophicum]
VIYLDTSALAKLLIAEPETPELQTWLTAQSGQGEYAVTSALGRVELMRVVARYGEPGLADRARYLLDGLDILPLAEPVIA
LAETIGPPTLCSLDAIHLAAAAHIERELAVFVTYDHRLLDGCREVGLASASPGAAVP
VIYLDTSALAKLLIAEPETPELQTWLTAQSGQGEYAVTSALGRVELMRVVARYGEPGLADRARYLLDGLDILPLAEPVIA
LAETIGPPTLCSLDAIHLAAAAHIERELAVFVTYDHRLLDGCREVGLASASPGAAVP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|