Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-mazE/PIN(toxin) |
| Location | 2603519..2604328 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS13580 | Protein ID | WP_219069283.1 |
| Coordinates | 2603519..2603938 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M5I08_RS13585 | Protein ID | WP_219069281.1 |
| Coordinates | 2604080..2604328 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS13540 (M5I08_13540) | 2599055..2599897 | + | 843 | WP_219069293.1 | carbohydrate ABC transporter permease | - |
| M5I08_RS13545 (M5I08_13545) | 2599899..2600969 | + | 1071 | WP_219069291.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| M5I08_RS13550 (M5I08_13550) | 2600966..2601271 | - | 306 | Protein_2685 | cytochrome P450 | - |
| M5I08_RS13555 (M5I08_13555) | 2601277..2601715 | + | 439 | Protein_2686 | alpha-hydroxy-acid oxidizing protein | - |
| M5I08_RS13560 (M5I08_13560) | 2601989..2602162 | + | 174 | Protein_2687 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M5I08_RS13565 (M5I08_13565) | 2602538..2602882 | - | 345 | WP_219069289.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M5I08_RS13570 (M5I08_13570) | 2602879..2603121 | - | 243 | WP_219069287.1 | hypothetical protein | - |
| M5I08_RS13575 (M5I08_13575) | 2603292..2603522 | + | 231 | WP_219069285.1 | CopG family transcriptional regulator | - |
| M5I08_RS13580 (M5I08_13580) | 2603519..2603938 | + | 420 | WP_219069283.1 | PIN domain-containing protein | Toxin |
| M5I08_RS13585 (M5I08_13585) | 2604080..2604328 | + | 249 | WP_219069281.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| M5I08_RS13590 (M5I08_13590) | 2604322..2604666 | + | 345 | WP_219069279.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M5I08_RS13595 (M5I08_13595) | 2605258..2607021 | - | 1764 | WP_219069277.1 | oleate hydratase | - |
| M5I08_RS13600 (M5I08_13600) | 2607041..2607898 | - | 858 | WP_219069275.1 | 3-hydroxyacyl-CoA dehydrogenase | - |
| M5I08_RS13605 (M5I08_13605) | 2608230..2608484 | - | 255 | WP_249762768.1 | hypothetical protein | - |
| M5I08_RS13610 (M5I08_13610) | 2608670..2608840 | - | 171 | Protein_2697 | recombinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16083.12 Da Isoelectric Point: 8.6724
>T245131 WP_219069283.1 NZ_CP097320:2603519-2603938 [Candidatus Mycobacterium methanotrophicum]
VKFADTGWWVAWALPGDSRHNHALGMLGALGRSEQILTTNLVAGETWTFLRRKDSHRTALAFLDRLDTLRNAERLVVHRV
TEGQEAAAWDWLRKHDERVYSYVDATSFRVMRDRRLREALAFDQDFAATGFVEVRANPW
VKFADTGWWVAWALPGDSRHNHALGMLGALGRSEQILTTNLVAGETWTFLRRKDSHRTALAFLDRLDTLRNAERLVVHRV
TEGQEAAAWDWLRKHDERVYSYVDATSFRVMRDRRLREALAFDQDFAATGFVEVRANPW
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|