245130

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2603292..2603938 Replicon chromosome
Accession NZ_CP097320
Organism Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M5I08_RS13580 Protein ID WP_219069283.1
Coordinates 2603519..2603938 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag M5I08_RS13575 Protein ID WP_219069285.1
Coordinates 2603292..2603522 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5I08_RS13540 (M5I08_13540) 2599055..2599897 + 843 WP_219069293.1 carbohydrate ABC transporter permease -
M5I08_RS13545 (M5I08_13545) 2599899..2600969 + 1071 WP_219069291.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
M5I08_RS13550 (M5I08_13550) 2600966..2601271 - 306 Protein_2685 cytochrome P450 -
M5I08_RS13555 (M5I08_13555) 2601277..2601715 + 439 Protein_2686 alpha-hydroxy-acid oxidizing protein -
M5I08_RS13560 (M5I08_13560) 2601989..2602162 + 174 Protein_2687 type II toxin-antitoxin system PemK/MazF family toxin -
M5I08_RS13565 (M5I08_13565) 2602538..2602882 - 345 WP_219069289.1 type II toxin-antitoxin system PemK/MazF family toxin -
M5I08_RS13570 (M5I08_13570) 2602879..2603121 - 243 WP_219069287.1 hypothetical protein -
M5I08_RS13575 (M5I08_13575) 2603292..2603522 + 231 WP_219069285.1 CopG family transcriptional regulator Antitoxin
M5I08_RS13580 (M5I08_13580) 2603519..2603938 + 420 WP_219069283.1 PIN domain-containing protein Toxin
M5I08_RS13585 (M5I08_13585) 2604080..2604328 + 249 WP_219069281.1 ribbon-helix-helix protein, CopG family -
M5I08_RS13590 (M5I08_13590) 2604322..2604666 + 345 WP_219069279.1 type II toxin-antitoxin system PemK/MazF family toxin -
M5I08_RS13595 (M5I08_13595) 2605258..2607021 - 1764 WP_219069277.1 oleate hydratase -
M5I08_RS13600 (M5I08_13600) 2607041..2607898 - 858 WP_219069275.1 3-hydroxyacyl-CoA dehydrogenase -
M5I08_RS13605 (M5I08_13605) 2608230..2608484 - 255 WP_249762768.1 hypothetical protein -
M5I08_RS13610 (M5I08_13610) 2608670..2608840 - 171 Protein_2697 recombinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-131)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 16083.12 Da        Isoelectric Point: 8.6724

>T245130 WP_219069283.1 NZ_CP097320:2603519-2603938 [Candidatus Mycobacterium methanotrophicum]
VKFADTGWWVAWALPGDSRHNHALGMLGALGRSEQILTTNLVAGETWTFLRRKDSHRTALAFLDRLDTLRNAERLVVHRV
TEGQEAAAWDWLRKHDERVYSYVDATSFRVMRDRRLREALAFDQDFAATGFVEVRANPW

Download         Length: 420 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8188.36 Da        Isoelectric Point: 4.7469

>AT245130 WP_219069285.1 NZ_CP097320:2603292-2603522 [Candidatus Mycobacterium methanotrophicum]
MKTITITIPEELDLLAAAEARRRGISKSELIRMGLGTVLSPPLGESDEGLWRSLAGFGSHHVSVEPGEIDDVLYGK

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References