Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1664866..1665548 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS08990 | Protein ID | WP_219067311.1 |
| Coordinates | 1665120..1665548 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5I08_RS08985 | Protein ID | WP_219067310.1 |
| Coordinates | 1664866..1665123 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS08960 (M5I08_08960) | 1660274..1660789 | + | 516 | WP_219067305.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| M5I08_RS08965 (M5I08_08965) | 1660866..1662035 | + | 1170 | WP_219067306.1 | acyl-CoA dehydrogenase | - |
| M5I08_RS08970 (M5I08_08970) | 1662129..1662467 | - | 339 | WP_219067307.1 | hypothetical protein | - |
| M5I08_RS08975 (M5I08_08975) | 1662546..1663733 | - | 1188 | WP_219067308.1 | CoA transferase | - |
| M5I08_RS08980 (M5I08_08980) | 1663733..1664644 | - | 912 | WP_219067309.1 | class I SAM-dependent methyltransferase | - |
| M5I08_RS08985 (M5I08_08985) | 1664866..1665123 | + | 258 | WP_219067310.1 | CopG family transcriptional regulator | Antitoxin |
| M5I08_RS08990 (M5I08_08990) | 1665120..1665548 | + | 429 | WP_219067311.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5I08_RS08995 (M5I08_08995) | 1665555..1666334 | - | 780 | WP_219067312.1 | DUF2127 domain-containing protein | - |
| M5I08_RS09000 (M5I08_09000) | 1666411..1666758 | + | 348 | WP_219067313.1 | GNAT family N-acetyltransferase | - |
| M5I08_RS09005 (M5I08_09005) | 1666906..1667457 | + | 552 | WP_249763328.1 | hypothetical protein | - |
| M5I08_RS09010 (M5I08_09010) | 1667516..1669612 | - | 2097 | WP_219067368.1 | manganese-exporting P-type ATPase CtpC | - |
| M5I08_RS09015 (M5I08_09015) | 1669644..1669922 | - | 279 | WP_219067314.1 | DUF1490 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15526.64 Da Isoelectric Point: 4.8405
>T245127 WP_219067311.1 NZ_CP097320:1665120-1665548 [Candidatus Mycobacterium methanotrophicum]
MRLLDLNILIYAMDESSSRHQRARDWLDDTLSGSDTVAFAWQVLVGFVRLATRAAVFARPLTVDESFDVVDGWLAQPCVT
VVHPTDRHANVLRGLLIPLGAAGNLTSDAHLAALAIEHGAELCSTDVDFSRFSGVRWIDPLG
MRLLDLNILIYAMDESSSRHQRARDWLDDTLSGSDTVAFAWQVLVGFVRLATRAAVFARPLTVDESFDVVDGWLAQPCVT
VVHPTDRHANVLRGLLIPLGAAGNLTSDAHLAALAIEHGAELCSTDVDFSRFSGVRWIDPLG
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|