Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-YefM |
Location | 1256422..1256960 | Replicon | chromosome |
Accession | NZ_CP097320 | ||
Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M5I08_RS06860 | Protein ID | WP_219066353.1 |
Coordinates | 1256422..1256688 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5I08_RS06865 | Protein ID | WP_219066352.1 |
Coordinates | 1256685..1256960 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5I08_RS06830 (M5I08_06830) | 1252063..1252335 | + | 273 | Protein_1349 | ATP-binding protein | - |
M5I08_RS06835 (M5I08_06835) | 1252332..1252802 | - | 471 | WP_219066356.1 | transposase | - |
M5I08_RS06840 (M5I08_06840) | 1252913..1253038 | - | 126 | Protein_1351 | ATP-binding protein | - |
M5I08_RS06845 (M5I08_06845) | 1253037..1253315 | + | 279 | Protein_1352 | IS5/IS1182 family transposase | - |
M5I08_RS06850 (M5I08_06850) | 1254258..1255853 | + | 1596 | WP_219066355.1 | Na+/H+ antiporter | - |
M5I08_RS06855 (M5I08_06855) | 1256021..1256263 | - | 243 | WP_219066354.1 | hypothetical protein | - |
M5I08_RS06860 (M5I08_06860) | 1256422..1256688 | - | 267 | WP_219066353.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5I08_RS06865 (M5I08_06865) | 1256685..1256960 | - | 276 | WP_219066352.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M5I08_RS06870 (M5I08_06870) | 1257196..1257792 | - | 597 | WP_249763170.1 | DUF6431 domain-containing protein | - |
M5I08_RS06875 (M5I08_06875) | 1258011..1258846 | + | 836 | Protein_1358 | class I SAM-dependent methyltransferase | - |
M5I08_RS06880 (M5I08_06880) | 1259278..1260291 | - | 1014 | WP_219066351.1 | low-specificity L-threonine aldolase | - |
M5I08_RS26140 | 1260359..1260700 | - | 342 | WP_255564665.1 | isochorismatase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1252063..1252335 | 272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10186.74 Da Isoelectric Point: 11.2822
>T245126 WP_219066353.1 NZ_CP097320:c1256688-1256422 [Candidatus Mycobacterium methanotrophicum]
VSWTVGLASSARRDIDKLPPRVIPAVVEFIYGPLASDPRRIGKPLRENFHGHWSARRGDYRVLYMLDEHRQQIVIIRVGH
RSQVYRPG
VSWTVGLASSARRDIDKLPPRVIPAVVEFIYGPLASDPRRIGKPLRENFHGHWSARRGDYRVLYMLDEHRQQIVIIRVGH
RSQVYRPG
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|