Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 553793..554334 | Replicon | chromosome |
Accession | NZ_CP097320 | ||
Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M5I08_RS02995 | Protein ID | WP_219068331.1 |
Coordinates | 553793..554119 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M5I08_RS03000 | Protein ID | WP_219068330.1 |
Coordinates | 554116..554334 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5I08_RS02950 (M5I08_02950) | 549063..549497 | - | 435 | WP_219068336.1 | type II toxin-antitoxin system VapC family toxin | - |
M5I08_RS02955 (M5I08_02955) | 549494..549790 | - | 297 | WP_219068335.1 | toxin-antitoxin system HicB family antitoxin | - |
M5I08_RS02960 (M5I08_02960) | 549787..550065 | - | 279 | WP_249763089.1 | hypothetical protein | - |
M5I08_RS02965 (M5I08_02965) | 550043..550501 | + | 459 | WP_249763090.1 | AAA family ATPase | - |
M5I08_RS02970 (M5I08_02970) | 550443..551954 | + | 1512 | WP_249763091.1 | hypothetical protein | - |
M5I08_RS02975 (M5I08_02975) | 551951..552289 | + | 339 | WP_219068334.1 | hypothetical protein | - |
M5I08_RS02980 (M5I08_02980) | 552290..552952 | - | 663 | WP_219068333.1 | NUDIX domain-containing protein | - |
M5I08_RS02985 (M5I08_02985) | 553028..553321 | + | 294 | WP_249763092.1 | ADP-ribosylglycohydrolase family protein | - |
M5I08_RS02990 (M5I08_02990) | 553215..553763 | + | 549 | WP_249763468.1 | hypothetical protein | - |
M5I08_RS02995 (M5I08_02995) | 553793..554119 | - | 327 | WP_219068331.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M5I08_RS03000 (M5I08_03000) | 554116..554334 | - | 219 | WP_219068330.1 | antitoxin MazE family protein | Antitoxin |
M5I08_RS03005 (M5I08_03005) | 554382..554537 | - | 156 | WP_219068329.1 | hypothetical protein | - |
M5I08_RS03010 (M5I08_03010) | 554917..558297 | + | 3381 | WP_219068328.1 | TM0106 family RecB-like putative nuclease | - |
M5I08_RS03015 (M5I08_03015) | 558377..558535 | - | 159 | WP_249763093.1 | hypothetical protein | - |
M5I08_RS03020 (M5I08_03020) | 558793..559284 | + | 492 | Protein_593 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11553.40 Da Isoelectric Point: 7.8314
>T245123 WP_219068331.1 NZ_CP097320:c554119-553793 [Candidatus Mycobacterium methanotrophicum]
VRRGELWTAAGGKHYAGKPRPVLIVQDDRFDATSSITVCPLTSDPTEIPLLRVPLDPDDSNCLDAPSSIMIDKITTMARS
KLGARIGKVSDAGMLALSRSLVVFLGFA
VRRGELWTAAGGKHYAGKPRPVLIVQDDRFDATSSITVCPLTSDPTEIPLLRVPLDPDDSNCLDAPSSIMIDKITTMARS
KLGARIGKVSDAGMLALSRSLVVFLGFA
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|