Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 523757..524349 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS02840 | Protein ID | WP_219068354.1 |
| Coordinates | 523757..524155 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5I08_RS02845 | Protein ID | WP_219068353.1 |
| Coordinates | 524152..524349 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS02820 (M5I08_02820) | 519471..520055 | - | 585 | WP_219068357.1 | hypothetical protein | - |
| M5I08_RS02825 (M5I08_02825) | 520709..520858 | + | 150 | WP_219068356.1 | helix-turn-helix domain-containing protein | - |
| M5I08_RS02830 (M5I08_02830) | 520822..521943 | - | 1122 | WP_219068355.1 | Tn3 family transposase | - |
| M5I08_RS02835 (M5I08_02835) | 521900..523288 | - | 1389 | WP_219068363.1 | serine hydrolase domain-containing protein | - |
| M5I08_RS02840 (M5I08_02840) | 523757..524155 | - | 399 | WP_219068354.1 | PIN domain nuclease | Toxin |
| M5I08_RS02845 (M5I08_02845) | 524152..524349 | - | 198 | WP_219068353.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5I08_RS02850 (M5I08_02850) | 524474..524635 | + | 162 | WP_249763085.1 | hypothetical protein | - |
| M5I08_RS02855 (M5I08_02855) | 524714..525628 | + | 915 | WP_249763086.1 | serine hydrolase domain-containing protein | - |
| M5I08_RS02860 (M5I08_02860) | 525615..527336 | - | 1722 | WP_249763087.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| M5I08_RS02865 (M5I08_02865) | 528009..528422 | + | 414 | Protein_562 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14654.02 Da Isoelectric Point: 5.6343
>T245122 WP_219068354.1 NZ_CP097320:c524155-523757 [Candidatus Mycobacterium methanotrophicum]
VIVVDTSVWIDVLNDNPTPQAQRCVQLLESGEPIALTDVILTEVLQGLRSDREAALVERHLRAFPILRLEGLDDFVLAAK
LYRMARRAGVTIRKTLDCLIAAPCVHTGAPLLHADQDFDRLATCTPLRIWSS
VIVVDTSVWIDVLNDNPTPQAQRCVQLLESGEPIALTDVILTEVLQGLRSDREAALVERHLRAFPILRLEGLDDFVLAAK
LYRMARRAGVTIRKTLDCLIAAPCVHTGAPLLHADQDFDRLATCTPLRIWSS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|