Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
Location | 499251..499777 | Replicon | chromosome |
Accession | NZ_CP097320 | ||
Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | M5I08_RS02670 | Protein ID | WP_219069889.1 |
Coordinates | 499475..499777 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | Rv0298 | Uniprot ID | - |
Locus tag | M5I08_RS02665 | Protein ID | WP_219069891.1 |
Coordinates | 499251..499478 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5I08_RS02635 (M5I08_02635) | 495383..496270 | + | 888 | WP_249763074.1 | tyrosine-type recombinase/integrase | - |
M5I08_RS02645 (M5I08_02645) | 496558..497184 | - | 627 | WP_249763075.1 | hypothetical protein | - |
M5I08_RS02650 (M5I08_02650) | 497545..498531 | - | 987 | WP_219069897.1 | alpha/beta hydrolase | - |
M5I08_RS02655 (M5I08_02655) | 498604..498750 | - | 147 | WP_219069895.1 | hypothetical protein | - |
M5I08_RS02660 (M5I08_02660) | 498747..498881 | - | 135 | WP_219069893.1 | chorismate mutase | - |
M5I08_RS02665 (M5I08_02665) | 499251..499478 | + | 228 | WP_219069891.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M5I08_RS02670 (M5I08_02670) | 499475..499777 | + | 303 | WP_219069889.1 | toxin | Toxin |
M5I08_RS02675 (M5I08_02675) | 500164..500346 | + | 183 | WP_219069887.1 | hypothetical protein | - |
M5I08_RS02680 (M5I08_02680) | 500334..500687 | + | 354 | WP_219069885.1 | ferredoxin family protein | - |
M5I08_RS02685 (M5I08_02685) | 500765..501355 | + | 591 | WP_249763076.1 | transcriptional regulator | - |
M5I08_RS02690 (M5I08_02690) | 501352..501552 | + | 201 | Protein_527 | hypothetical protein | - |
M5I08_RS02695 (M5I08_02695) | 501984..502277 | + | 294 | WP_219069883.1 | hypothetical protein | - |
M5I08_RS02700 (M5I08_02700) | 502556..502816 | + | 261 | Protein_529 | IS200/IS605 family transposase | - |
M5I08_RS02705 (M5I08_02705) | 502906..503832 | - | 927 | WP_219069909.1 | questin oxidase family protein | - |
M5I08_RS02710 (M5I08_02710) | 503904..504230 | - | 327 | WP_219069879.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10385.12 Da Isoelectric Point: 4.1313
>T245121 WP_219069889.1 NZ_CP097320:499475-499777 [Candidatus Mycobacterium methanotrophicum]
VITPGDITPRRDTDQELYVIVLSNAIHLAAATGRVITCPFIPGEIPSGTMAMIVTVQQPKGVVLPELIQWLPVAALDEPI
GNIGGAALADTTVTVTALVS
VITPGDITPRRDTDQELYVIVLSNAIHLAAATGRVITCPFIPGEIPSGTMAMIVTVQQPKGVVLPELIQWLPVAALDEPI
GNIGGAALADTTVTVTALVS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|