Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 11009..11583 Replicon plasmid pl_URK_4b
Accession NZ_CP097318
Organism Leptospira interrogans strain N 116

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag MY415_RS19625 Protein ID WP_025177725.1
Coordinates 11009..11353 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID M6U553
Locus tag MY415_RS19630 Protein ID WP_000443825.1
Coordinates 11347..11583 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MY415_RS19600 (MY415_19600) 6157..6327 - 171 WP_002188134.1 hypothetical protein -
MY415_RS19605 (MY415_19605) 6652..7185 + 534 WP_002188141.1 transferase hexapeptide repeat protein -
MY415_RS19610 (MY415_19610) 7208..8335 - 1128 Protein_11 IS3 family transposase -
MY415_RS19615 (MY415_19615) 9439..9750 + 312 WP_002188299.1 hypothetical protein -
MY415_RS19620 (MY415_19620) 9839..10986 + 1148 WP_100218943.1 IS3-like element IS1500B family transposase -
MY415_RS19625 (MY415_19625) 11009..11353 - 345 WP_025177725.1 endoribonuclease MazF Toxin
MY415_RS19630 (MY415_19630) 11347..11583 - 237 WP_000443825.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
MY415_RS19635 (MY415_19635) 11935..12351 - 417 WP_000402981.1 hypothetical protein -
MY415_RS19640 (MY415_19640) 12400..12612 - 213 WP_000447737.1 hypothetical protein -
MY415_RS19645 (MY415_19645) 12915..14062 + 1148 WP_100219858.1 IS3-like element IS1500B family transposase -
MY415_RS19650 (MY415_19650) 14290..14535 + 246 WP_001077269.1 ribbon-helix-helix domain-containing protein -
MY415_RS19655 (MY415_19655) 14535..14954 + 420 WP_000921772.1 putative toxin-antitoxin system toxin component, PIN family -
MY415_RS19660 (MY415_19660) 15322..16191 - 870 WP_000041747.1 Rpn family recombination-promoting nuclease/putative transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..64666 64666
- inside IScluster/Tn - - 7208..14062 6854


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(11-111)

Antitoxin

Antitoxin PemI-like

(1-78)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13034.29 Da        Isoelectric Point: 9.8852

>T245120 WP_025177725.1 NZ_CP097318:c11353-11009 [Leptospira interrogans]
MVKYRNYTPEKGDIVWLNFTPQAGHEQKGRRPALVLSPKEYNSKTGLAIFCPITSKIKGYPFEVLIKSKKIDGVILSDQV
KNLDWTIREAEFIESINKVSLKEVLDNIKLLILT

Download         Length: 345 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8728.95 Da        Isoelectric Point: 5.6663

>AT245120 WP_000443825.1 NZ_CP097318:c11583-11347 [Leptospira interrogans]
MESIIQKWGNSLGIRIPKAMATELELNDGSHVELQYEGDKIVIYPMKKASLEDKLSKITKQNLHSEISTGNSIGNEAW

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0F6HC33

References