Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 3263558..3264186 | Replicon | chromosome |
Accession | NZ_CP097315 | ||
Organism | Leptospira interrogans strain N 116 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q8F7E4 |
Locus tag | MY415_RS13720 | Protein ID | WP_000281042.1 |
Coordinates | 3263788..3264186 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q8F7E3 |
Locus tag | MY415_RS13715 | Protein ID | WP_001192482.1 |
Coordinates | 3263558..3263788 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MY415_RS20050 | 3259380..3259514 | + | 135 | WP_002188572.1 | hypothetical protein | - |
MY415_RS13685 (MY415_13685) | 3259551..3259910 | + | 360 | WP_002188605.1 | tyrosine-type recombinase/integrase | - |
MY415_RS13690 (MY415_13690) | 3259942..3260964 | + | 1023 | WP_000288518.1 | hypothetical protein | - |
MY415_RS13695 (MY415_13695) | 3261019..3261546 | + | 528 | WP_002188620.1 | hypothetical protein | - |
MY415_RS13700 (MY415_13700) | 3261825..3262160 | + | 336 | WP_000669388.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MY415_RS13705 (MY415_13705) | 3262157..3262456 | + | 300 | WP_000769809.1 | helix-turn-helix transcriptional regulator | - |
MY415_RS13710 (MY415_13710) | 3262577..3263206 | + | 630 | WP_000639168.1 | hypothetical protein | - |
MY415_RS13715 (MY415_13715) | 3263558..3263788 | + | 231 | WP_001192482.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MY415_RS13720 (MY415_13720) | 3263788..3264186 | + | 399 | WP_000281042.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MY415_RS13725 (MY415_13725) | 3264284..3264583 | + | 300 | Protein_2728 | hypothetical protein | - |
MY415_RS13730 (MY415_13730) | 3264605..3264832 | + | 228 | WP_000130601.1 | hypothetical protein | - |
MY415_RS13735 (MY415_13735) | 3264974..3266050 | + | 1077 | WP_001170569.1 | hypothetical protein | - |
MY415_RS13740 (MY415_13740) | 3266051..3266509 | + | 459 | WP_001239006.1 | GNAT family N-acetyltransferase | - |
MY415_RS13745 (MY415_13745) | 3266726..3267588 | - | 863 | Protein_2732 | hypothetical protein | - |
MY415_RS13750 (MY415_13750) | 3268099..3268866 | - | 768 | WP_000636953.1 | DUF1554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15139.76 Da Isoelectric Point: 9.6893
>T245119 WP_000281042.1 NZ_CP097315:3263788-3264186 [Leptospira interrogans]
MYLLDTNICIFLIKKKNATLLENLKKKLNKDLFVSSLTVAELEFGIQKSEFKEKNKVALIEFLTIFNILSFSDKDAESYG
IIRADLERKGNVIGSIDMLLAAQAIANNYIFVTNNTKEFKRIKALKIENWTQ
MYLLDTNICIFLIKKKNATLLENLKKKLNKDLFVSSLTVAELEFGIQKSEFKEKNKVALIEFLTIFNILSFSDKDAESYG
IIRADLERKGNVIGSIDMLLAAQAIANNYIFVTNNTKEFKRIKALKIENWTQ
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6HAN6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6HAF7 |