Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpIK/PemK(toxin) |
Location | 1023053..1023629 | Replicon | chromosome |
Accession | NZ_CP097315 | ||
Organism | Leptospira interrogans strain N 116 |
Toxin (Protein)
Gene name | chpK | Uniprot ID | Q93MT8 |
Locus tag | MY415_RS04475 | Protein ID | WP_000617906.1 |
Coordinates | 1023288..1023629 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | chpI | Uniprot ID | Q93MT9 |
Locus tag | MY415_RS04470 | Protein ID | WP_000844758.1 |
Coordinates | 1023053..1023301 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MY415_RS04455 (MY415_04455) | 1018704..1020686 | + | 1983 | WP_000836894.1 | GAF domain-containing protein | - |
MY415_RS04460 (MY415_04460) | 1021328..1021786 | - | 459 | WP_000453267.1 | hypothetical protein | - |
MY415_RS04465 (MY415_04465) | 1021940..1022236 | + | 297 | WP_000477061.1 | helix-turn-helix transcriptional regulator | - |
MY415_RS04470 (MY415_04470) | 1023053..1023301 | + | 249 | WP_000844758.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MY415_RS04475 (MY415_04475) | 1023288..1023629 | + | 342 | WP_000617906.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MY415_RS04480 (MY415_04480) | 1024724..1025236 | + | 513 | WP_000079224.1 | VOC family protein | - |
MY415_RS04485 (MY415_04485) | 1025920..1026513 | + | 594 | WP_001226990.1 | dihydrofolate reductase family protein | - |
MY415_RS04490 (MY415_04490) | 1026585..1027472 | + | 888 | WP_002188401.1 | hypothetical protein | - |
MY415_RS04495 (MY415_04495) | 1027590..1028336 | + | 747 | WP_000617027.1 | GNAT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12372.25 Da Isoelectric Point: 6.3272
>T245118 WP_000617906.1 NZ_CP097315:1023288-1023629 [Leptospira interrogans]
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSNINTIVSIAITSNLNLSEAPGNVFISKKDSSLSKDSVINVSQIV
TLDKERFLNKAGKLKSNKLGEVEIGLKLVTGLD
MIRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNQSNINTIVSIAITSNLNLSEAPGNVFISKKDSSLSKDSVINVSQIV
TLDKERFLNKAGKLKSNKLGEVEIGLKLVTGLD
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M4MS74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6HD92 |