Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 2850213..2850852 | Replicon | chromosome |
Accession | NZ_CP097314 | ||
Organism | Rummeliibacillus sp. G93 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A143HEK3 |
Locus tag | M2M59_RS14360 | Protein ID | WP_066790273.1 |
Coordinates | 2850213..2850563 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M2M59_RS14365 | Protein ID | WP_236717644.1 |
Coordinates | 2850568..2850852 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2M59_RS14335 (M2M59_14335) | 2845501..2847654 | - | 2154 | WP_147197145.1 | Tex family protein | - |
M2M59_RS14340 (M2M59_14340) | 2847758..2848537 | - | 780 | WP_066790265.1 | RNA polymerase sigma factor SigB | - |
M2M59_RS14345 (M2M59_14345) | 2848515..2848985 | - | 471 | WP_066790267.1 | anti-sigma B factor RsbW | - |
M2M59_RS14350 (M2M59_14350) | 2848972..2849313 | - | 342 | WP_147197143.1 | STAS domain-containing protein | - |
M2M59_RS14355 (M2M59_14355) | 2849503..2849916 | - | 414 | WP_147197141.1 | anti-sigma regulatory factor | - |
M2M59_RS14360 (M2M59_14360) | 2850213..2850563 | - | 351 | WP_066790273.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2M59_RS14365 (M2M59_14365) | 2850568..2850852 | - | 285 | WP_236717644.1 | transcriptional regulator | Antitoxin |
M2M59_RS14370 (M2M59_14370) | 2851057..2852181 | - | 1125 | WP_249774936.1 | alanine racemase | - |
M2M59_RS14375 (M2M59_14375) | 2852356..2853627 | - | 1272 | WP_249774937.1 | outer membrane lipoprotein carrier protein LolA | - |
M2M59_RS14380 (M2M59_14380) | 2853681..2854034 | - | 354 | WP_066790282.1 | holo-ACP synthase | - |
M2M59_RS14385 (M2M59_14385) | 2854103..2854711 | + | 609 | WP_249774938.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12818.94 Da Isoelectric Point: 7.0151
>T245117 WP_066790273.1 NZ_CP097314:c2850563-2850213 [Rummeliibacillus sp. G93]
MNVKRGDVFFADLSPVVGSEQGGTRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQL
RTIDKSRLTDKITQLDGPLMVKVEEALEISLGLLKF
MNVKRGDVFFADLSPVVGSEQGGTRPVLVIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQL
RTIDKSRLTDKITQLDGPLMVKVEEALEISLGLLKF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|