Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 60417..60979 | Replicon | plasmid p.J383 |
| Accession | NZ_CP097295 | ||
| Organism | Vibrio sp. J383 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | M4S28_RS25815 | Protein ID | WP_249633856.1 |
| Coordinates | 60417..60719 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | M4S28_RS25820 | Protein ID | WP_249633857.1 |
| Coordinates | 60719..60979 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4S28_RS25800 (M4S28_25800) | 56584..57249 | - | 666 | WP_249633878.1 | IS6 family transposase | - |
| M4S28_RS25805 (M4S28_25805) | 57500..57982 | - | 483 | WP_132714993.1 | hypothetical protein | - |
| M4S28_RS25810 (M4S28_25810) | 58692..60188 | + | 1497 | WP_249633855.1 | nuclease-related domain-containing protein | - |
| M4S28_RS25815 (M4S28_25815) | 60417..60719 | - | 303 | WP_249633856.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4S28_RS25820 (M4S28_25820) | 60719..60979 | - | 261 | WP_249633857.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M4S28_RS25825 (M4S28_25825) | 61195..61761 | + | 567 | WP_249633858.1 | recombinase family protein | - |
| M4S28_RS25830 (M4S28_25830) | 61933..62202 | + | 270 | WP_102340850.1 | hypothetical protein | - |
| M4S28_RS25835 (M4S28_25835) | 62323..62745 | - | 423 | WP_249633859.1 | VOC family protein | - |
| M4S28_RS25840 (M4S28_25840) | 63035..63658 | - | 624 | WP_249633860.1 | DJ-1/PfpI family protein | - |
| M4S28_RS25845 (M4S28_25845) | 64034..64531 | - | 498 | WP_058118984.1 | DUF4865 family protein | - |
| M4S28_RS25850 (M4S28_25850) | 64528..64932 | - | 405 | WP_249633861.1 | tautomerase family protein | - |
| M4S28_RS25855 (M4S28_25855) | 64923..65258 | - | 336 | WP_058118982.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..201166 | 201166 | |
| - | flank | IS/Tn | - | - | 56584..57225 | 641 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11788.57 Da Isoelectric Point: 9.8773
>T245116 WP_249633856.1 NZ_CP097295:c60719-60417 [Vibrio sp. J383]
MTHYKLSSSAQSDLIEIRRYTLERWGQAQWTTYFSELKQSMELLANNKLLGIEVSEVGQNYFRFPLKRHVIYYIQKQDHI
IITAVLGKHMSPAKHFSQLS
MTHYKLSSSAQSDLIEIRRYTLERWGQAQWTTYFSELKQSMELLANNKLLGIEVSEVGQNYFRFPLKRHVIYYIQKQDHI
IITAVLGKHMSPAKHFSQLS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|