Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3622149..3622791 | Replicon | chromosome |
| Accession | NZ_CP097291 | ||
| Organism | Providencia sp. PROV188 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A6L6F8F2 |
| Locus tag | M5X66_RS16630 | Protein ID | WP_036948921.1 |
| Coordinates | 3622149..3622556 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A4R3NJB3 |
| Locus tag | M5X66_RS16635 | Protein ID | WP_036948919.1 |
| Coordinates | 3622549..3622791 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5X66_RS16600 (M5X66_16600) | 3617721..3619049 | - | 1329 | WP_036948929.1 | N-acetylmuramoyl-L-alanine amidase AmiB | - |
| M5X66_RS16605 (M5X66_16605) | 3619064..3619528 | - | 465 | WP_036948926.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| M5X66_RS16610 (M5X66_16610) | 3619743..3620900 | + | 1158 | WP_108478804.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| M5X66_RS16630 (M5X66_16630) | 3622149..3622556 | - | 408 | WP_036948921.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| M5X66_RS16635 (M5X66_16635) | 3622549..3622791 | - | 243 | WP_036948919.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5X66_RS16640 (M5X66_16640) | 3622875..3623417 | - | 543 | WP_036948917.1 | oligoribonuclease | - |
| M5X66_RS16645 (M5X66_16645) | 3623555..3624607 | + | 1053 | WP_036948915.1 | small ribosomal subunit biogenesis GTPase RsgA | - |
| M5X66_RS16650 (M5X66_16650) | 3624741..3625634 | + | 894 | WP_036948913.1 | archaetidylserine decarboxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15161.42 Da Isoelectric Point: 7.3226
>T245110 WP_036948921.1 NZ_CP097291:c3622556-3622149 [Providencia sp. PROV188]
MIKYLLDTNIVIFTIKRRPAALLPKFNQHADQLAISTITLAELVFGAEKSMNPERNLAVVNDFVSRLCVLPYDEAAACHY
GDIRANLEKQGKKIGENDLHIAAHARSKGLIVVTNNTREFERVDGLRLEDWVNSS
MIKYLLDTNIVIFTIKRRPAALLPKFNQHADQLAISTITLAELVFGAEKSMNPERNLAVVNDFVSRLCVLPYDEAAACHY
GDIRANLEKQGKKIGENDLHIAAHARSKGLIVVTNNTREFERVDGLRLEDWVNSS
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6L6F8F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R3NJB3 |