Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 3527314..3527963 Replicon chromosome
Accession NZ_CP097291
Organism Providencia sp. PROV188

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag M5X66_RS16135 Protein ID WP_036949118.1
Coordinates 3527314..3527733 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A6L6FAJ1
Locus tag M5X66_RS16140 Protein ID WP_036949116.1
Coordinates 3527730..3527963 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5X66_RS16110 (M5X66_16110) 3522589..3523296 + 708 WP_270104037.1 phosphonate utilization transcriptional regulator PhnR -
M5X66_RS16115 (M5X66_16115) 3523432..3524445 + 1014 WP_270104038.1 2-aminoethylphosphonate ABC transporter substrate-binding protein -
M5X66_RS16120 (M5X66_16120) 3524453..3525562 + 1110 WP_108478839.1 2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT -
M5X66_RS16125 (M5X66_16125) 3525564..3526424 + 861 WP_108478838.1 2-aminoethylphosphonate ABC transporter permease subunit -
M5X66_RS16130 (M5X66_16130) 3526427..3527224 + 798 WP_270103734.1 2-aminoethylphosphonate ABC transport system, membrane component PhnV -
M5X66_RS16135 (M5X66_16135) 3527314..3527733 - 420 WP_036949118.1 type II toxin-antitoxin system VapC family toxin Toxin
M5X66_RS16140 (M5X66_16140) 3527730..3527963 - 234 WP_036949116.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5X66_RS16150 (M5X66_16150) 3528292..3529227 + 936 WP_270103735.1 aspartate carbamoyltransferase -
M5X66_RS16155 (M5X66_16155) 3529238..3529702 + 465 WP_036949112.1 aspartate carbamoyltransferase regulatory subunit -
M5X66_RS16160 (M5X66_16160) 3529795..3530181 + 387 WP_108478834.1 2-iminobutanoate/2-iminopropanoate deaminase -
M5X66_RS16165 (M5X66_16165) 3530422..3531603 + 1182 WP_036949105.1 MFS transporter -
M5X66_RS16170 (M5X66_16170) 3531596..3532504 - 909 WP_154610099.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-128)

Antitoxin

SpoVT-AbrB domain

(9-54)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15496.96 Da        Isoelectric Point: 7.2913

>T245109 WP_036949118.1 NZ_CP097291:c3527733-3527314 [Providencia sp. PROV188]
VTKLYMLDTNICSFIMREQPMYLLQKLQDCVMHRHSIVISAITYSEMRFGAIGKKASPKHNFLVDAFCERLDGILAWDKD
AIDATTAIKKALTEAGTPIGNNDTAIAGHALATNSILVTNNTREFSRVLGLKLEDWLQP

Download         Length: 420 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8932.26 Da        Isoelectric Point: 4.8660

>AT245109 WP_036949116.1 NZ_CP097291:c3527963-3527730 [Providencia sp. PROV188]
MVTKIVAVFKNGNNRAVRLPKDIDFEGVNELEISREGNRIILRPVKPNWLSLRDEDKADKDFLLEREDVIEDGRIVL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6L6FAJ1

References