Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2449472..2450128 | Replicon | chromosome |
| Accession | NZ_CP097291 | ||
| Organism | Providencia sp. PROV188 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M5X66_RS11230 | Protein ID | WP_132495542.1 |
| Coordinates | 2449472..2449657 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A4R3NPH0 |
| Locus tag | M5X66_RS11235 | Protein ID | WP_036949521.1 |
| Coordinates | 2449712..2450128 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5X66_RS11210 (M5X66_11205) | 2445389..2446477 | - | 1089 | WP_036949529.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
| M5X66_RS11215 (M5X66_11210) | 2446480..2447340 | - | 861 | WP_036949527.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
| M5X66_RS11220 (M5X66_11215) | 2447340..2448170 | - | 831 | WP_036949525.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
| M5X66_RS11225 (M5X66_11220) | 2448170..2449192 | - | 1023 | WP_036949523.1 | sulfate ABC transporter substrate-binding protein | - |
| M5X66_RS11230 (M5X66_11225) | 2449472..2449657 | + | 186 | WP_132495542.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5X66_RS11235 (M5X66_11230) | 2449712..2450128 | + | 417 | WP_036949521.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5X66_RS11240 (M5X66_11235) | 2450179..2451075 | - | 897 | WP_036949519.1 | Dyp-type peroxidase | - |
| M5X66_RS11245 (M5X66_11240) | 2451312..2451896 | - | 585 | WP_270103534.1 | RpoE-regulated lipoprotein | - |
| M5X66_RS11250 (M5X66_11245) | 2451999..2452430 | - | 432 | WP_036949558.1 | GNAT family acetyltransferase | - |
| M5X66_RS11255 (M5X66_11250) | 2452567..2453490 | + | 924 | WP_036949516.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| M5X66_RS11260 (M5X66_11255) | 2453640..2454770 | + | 1131 | WP_270103535.1 | M4 family metallopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7012.22 Da Isoelectric Point: 10.7918
>T245107 WP_132495542.1 NZ_CP097291:2449472-2449657 [Providencia sp. PROV188]
MKSSELINMLENNGWKLERVKGSHHQFSHPDFSIVITVPHPRKDLKIGTLNQILKAAKLKH
MKSSELINMLENNGWKLERVKGSHHQFSHPDFSIVITVPHPRKDLKIGTLNQILKAAKLKH
Download Length: 186 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15701.45 Da Isoelectric Point: 4.6077
>AT245107 WP_036949521.1 NZ_CP097291:2449712-2450128 [Providencia sp. PROV188]
MLYPAFIEIDHDGSASGWFPDIEGCTFAGDNIENAYTDAKSALDAHFELLSEKGFEIPEPKSQQEHLNRTKDEYQNGLWL
FVDIDMDKYDGRAERINITLPHRLLHRIDTLVKANPEYGSRSGFIAAAARKELQKTDQ
MLYPAFIEIDHDGSASGWFPDIEGCTFAGDNIENAYTDAKSALDAHFELLSEKGFEIPEPKSQQEHLNRTKDEYQNGLWL
FVDIDMDKYDGRAERINITLPHRLLHRIDTLVKANPEYGSRSGFIAAAARKELQKTDQ
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|