Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
Location | 5579606..5580288 | Replicon | chromosome |
Accession | NZ_CP097289 | ||
Organism | Streptomyces durmitorensis strain MS405 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M4V62_RS25050 | Protein ID | WP_249589471.1 |
Coordinates | 5579884..5580288 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M4V62_RS25045 | Protein ID | WP_249589470.1 |
Coordinates | 5579606..5579887 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4V62_RS25025 (M4V62_25025) | 5575600..5576166 | + | 567 | WP_249589467.1 | hypothetical protein | - |
M4V62_RS25030 (M4V62_25030) | 5576163..5577728 | + | 1566 | WP_283779167.1 | serine/threonine-protein kinase | - |
M4V62_RS25035 (M4V62_25035) | 5577861..5578526 | + | 666 | WP_249589468.1 | SurA N-terminal domain-containing protein | - |
M4V62_RS25040 (M4V62_25040) | 5578585..5579574 | + | 990 | WP_249589469.1 | nucleoside triphosphate pyrophosphohydrolase | - |
M4V62_RS25045 (M4V62_25045) | 5579606..5579887 | + | 282 | WP_249589470.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M4V62_RS25050 (M4V62_25050) | 5579884..5580288 | + | 405 | WP_249589471.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4V62_RS25055 (M4V62_25055) | 5580335..5581702 | + | 1368 | WP_249589472.1 | cytochrome P450 | - |
M4V62_RS25060 (M4V62_25060) | 5581839..5582831 | + | 993 | WP_249589473.1 | transglycosylase family protein | - |
M4V62_RS25065 (M4V62_25065) | 5583208..5583918 | + | 711 | WP_249589474.1 | transglycosylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14797.92 Da Isoelectric Point: 5.7514
>T245105 WP_249589471.1 NZ_CP097289:5579884-5580288 [Streptomyces durmitorensis]
VIYLDSCVLLKFIKPEKETEALRAWRAGLPDGTELLGSELARLEITRTLYRAGVDHQRVPFFVGQAVRGVYLADVTTTVM
ARAAAYRTQRLGTLDAIHLASADPFRQDITEFVTYGQELARAAEELGFPVSSPA
VIYLDSCVLLKFIKPEKETEALRAWRAGLPDGTELLGSELARLEITRTLYRAGVDHQRVPFFVGQAVRGVYLADVTTTVM
ARAAAYRTQRLGTLDAIHLASADPFRQDITEFVTYGQELARAAEELGFPVSSPA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|