Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-DUF971
Location 30505..31100 Replicon plasmid pDR208
Accession NZ_CP097287
Organism Pseudomonas viridiflava strain JACO-C-5

Toxin (Protein)


Gene name PumA Uniprot ID G9G7G3
Locus tag M4X66_RS27185 Protein ID WP_011475355.1
Coordinates 30505..30807 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID G9G7G2
Locus tag M4X66_RS27190 Protein ID WP_011475354.1
Coordinates 30804..31100 (+) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4X66_RS27130 25626..25844 - 219 WP_017124952.1 hypothetical protein -
M4X66_RS27135 26211..26633 - 423 WP_054076687.1 hypothetical protein -
M4X66_RS27140 26645..26863 - 219 WP_017124954.1 hypothetical protein -
M4X66_RS27145 26947..28440 - 1494 WP_249584768.1 DNA cytosine methyltransferase -
M4X66_RS27150 28402..28662 + 261 WP_249584769.1 hypothetical protein -
M4X66_RS27155 28681..28923 - 243 WP_054076685.1 hypothetical protein -
M4X66_RS27160 29058..29360 - 303 WP_155511826.1 hypothetical protein -
M4X66_RS27165 29366..29662 - 297 WP_155511825.1 hypothetical protein -
M4X66_RS27170 29701..29853 - 153 WP_155511824.1 hypothetical protein -
M4X66_RS27175 29856..30017 - 162 WP_169880999.1 hypothetical protein -
M4X66_RS27180 30077..30295 - 219 WP_169881000.1 hypothetical protein -
M4X66_RS27185 30505..30807 + 303 WP_011475355.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M4X66_RS27190 30804..31100 + 297 WP_011475354.1 putative addiction module antidote protein Antitoxin
M4X66_RS27195 31692..32120 + 429 WP_054076689.1 S24 family peptidase -
M4X66_RS27200 32110..33393 + 1284 WP_054076681.1 Y-family DNA polymerase -
M4X66_RS27205 34024..35292 - 1269 WP_081003827.1 DUF1173 family protein -
M4X66_RS27210 35303..35665 - 363 WP_054076680.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..42253 42253


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-96)

Antitoxin

Uncharacterized protein HI1420

(9-92)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11247.96 Da        Isoelectric Point: 9.9233

>T245102 WP_011475355.1 NZ_CP097287:30505-30807 [Pseudomonas viridiflava]
MKTIIQTATYMTWERKLRDKKAKLIIAARVLRVAHGLLGDVQPVGQGVSELRIHHGPGYRVYFQQRGDQLVLLLCGGDKS
SQARDIETAKTLASQWSEDE

Download         Length: 303 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 10482.08 Da        Isoelectric Point: 5.5740

>AT245102 WP_011475354.1 NZ_CP097287:30804-31100 [Pseudomonas viridiflava]
MKEPIYEYDPAELLTDAESIAIFMADAFESGDASFIAQALSVVARAKGMTAIAKEAGVTRAHLYQLKNGNPTLKTMIGVM
RAVGLDMTAKQHVDVAHG

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G7G3

Antitoxin

Source ID Structure
AlphaFold DB G9G7G2

References