Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09812-MazE
Location 3158134..3158720 Replicon chromosome
Accession NZ_CP097269
Organism Acidovorax sp. GBBC 1281

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag M5C96_RS14760 Protein ID WP_272563913.1
Coordinates 3158376..3158720 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag M5C96_RS14755 Protein ID WP_272563912.1
Coordinates 3158134..3158376 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5C96_RS14725 (M5C96_14735) 3154646..3155233 - 588 WP_272563907.1 hypothetical protein -
M5C96_RS14730 (M5C96_14740) 3155362..3155781 + 420 WP_272563908.1 XRE family transcriptional regulator -
M5C96_RS14735 (M5C96_14745) 3155819..3156085 + 267 WP_272563909.1 hypothetical protein -
M5C96_RS14740 (M5C96_14750) 3156151..3156471 + 321 WP_272563910.1 hypothetical protein -
M5C96_RS14745 (M5C96_14755) 3156477..3156767 + 291 WP_272563911.1 hypothetical protein -
M5C96_RS14750 (M5C96_14760) 3156859..3157944 - 1086 WP_272569564.1 IS5 family transposase -
M5C96_RS14755 (M5C96_14765) 3158134..3158376 + 243 WP_272563912.1 hypothetical protein Antitoxin
M5C96_RS14760 (M5C96_14770) 3158376..3158720 + 345 WP_272563913.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M5C96_RS14765 (M5C96_14775) 3159054..3159155 + 102 Protein_2913 IS5/IS1182 family transposase -
M5C96_RS14770 (M5C96_14780) 3159153..3160247 - 1095 WP_272563777.1 IS630 family transposase -
M5C96_RS14775 (M5C96_14785) 3160263..3161165 + 903 Protein_2915 IS5 family transposase -
M5C96_RS14780 (M5C96_14790) 3161184..3161387 - 204 WP_272563914.1 hypothetical protein -
M5C96_RS14785 (M5C96_14795) 3161429..3162379 - 951 WP_272563915.1 IS5 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - hsiC1/vipB / hsiB1/vipA 3082494..3161496 79002


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(6-111)

Antitoxin

Antitoxin PemI-like

(1-77)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 12767.57 Da        Isoelectric Point: 7.4364

>T245098 WP_272563913.1 NZ_CP097269:3158376-3158720 [Acidovorax sp. GBBC 1281]
MFIPNRGDIVHLEFDPASGKEMKGKHYALVLSSKEFNRRGLAMVCPISQGAAESARTHGTLVSLMNTGTDTQGTVHCHQL
KSLDWKERRFKHKETVPDEVMDEVNARVSAILFD

Download         Length: 345 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8623.21 Da        Isoelectric Point: 6.2568

>AT245098 WP_272563912.1 NZ_CP097269:3158134-3158376 [Acidovorax sp. GBBC 1281]
MKLSIQKWGNSAALRLPVGMLSALGAKVGDAFEVDLSAGQVLLRVAKPRYKLADLLAEMPEQLPRVEGWDAMTAVGLEVM

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References