Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 1884979..1885612 | Replicon | chromosome |
Accession | NZ_CP097266 | ||
Organism | Acidovorax sp. NCPPB 3859 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5C97_RS08735 | Protein ID | WP_271451387.1 |
Coordinates | 1885199..1885612 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M5C97_RS08730 | Protein ID | WP_271451386.1 |
Coordinates | 1884979..1885212 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5C97_RS08705 (M5C97_08700) | 1880421..1880798 | + | 378 | WP_271453924.1 | RidA family protein | - |
M5C97_RS08710 (M5C97_08705) | 1880818..1881819 | + | 1002 | WP_271453925.1 | tripartite tricarboxylate transporter substrate binding protein | - |
M5C97_RS08715 (M5C97_08710) | 1881988..1882710 | - | 723 | WP_271453926.1 | class I SAM-dependent methyltransferase | - |
M5C97_RS08720 (M5C97_08715) | 1882966..1883928 | - | 963 | WP_271453980.1 | IS5 family transposase | - |
M5C97_RS08725 (M5C97_08720) | 1884315..1884650 | - | 336 | WP_271451385.1 | hypothetical protein | - |
M5C97_RS08730 (M5C97_08725) | 1884979..1885212 | + | 234 | WP_271451386.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M5C97_RS08735 (M5C97_08730) | 1885199..1885612 | + | 414 | WP_271451387.1 | PIN domain-containing protein | Toxin |
M5C97_RS08740 (M5C97_08735) | 1885633..1885995 | + | 363 | WP_271451388.1 | DUF3742 family protein | - |
M5C97_RS08745 (M5C97_08740) | 1886006..1887526 | - | 1521 | Protein_1732 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
M5C97_RS08750 (M5C97_08745) | 1887681..1889333 | - | 1653 | WP_271451389.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1882966..1883928 | 962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15153.49 Da Isoelectric Point: 6.3220
>T245096 WP_271451387.1 NZ_CP097266:1885199-1885612 [Acidovorax sp. NCPPB 3859]
MAADKGKVFLDSNVVLYLLSENAAKADSAEALLQRRPVISVQVLNEVTHVCVRKLKMGWSEVGQFLALVRGFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
MAADKGKVFLDSNVVLYLLSENAAKADSAEALLQRRPVISVQVLNEVTHVCVRKLKMGWSEVGQFLALVRGFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|