Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 1885086..1885719 | Replicon | chromosome |
| Accession | NZ_CP097265 | ||
| Organism | Acidovorax sp. GBBC 712 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5C94_RS08730 | Protein ID | WP_271451387.1 |
| Coordinates | 1885306..1885719 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5C94_RS08725 | Protein ID | WP_271451386.1 |
| Coordinates | 1885086..1885319 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5C94_RS08700 (M5C94_08695) | 1880528..1880905 | + | 378 | WP_271453924.1 | RidA family protein | - |
| M5C94_RS08705 (M5C94_08700) | 1880925..1881926 | + | 1002 | WP_271453925.1 | tripartite tricarboxylate transporter substrate binding protein | - |
| M5C94_RS08710 (M5C94_08705) | 1882095..1882817 | - | 723 | WP_271453926.1 | class I SAM-dependent methyltransferase | - |
| M5C94_RS08715 (M5C94_08710) | 1883073..1884035 | - | 963 | WP_271453980.1 | IS5 family transposase | - |
| M5C94_RS08720 (M5C94_08715) | 1884422..1884757 | - | 336 | WP_271451385.1 | hypothetical protein | - |
| M5C94_RS08725 (M5C94_08720) | 1885086..1885319 | + | 234 | WP_271451386.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M5C94_RS08730 (M5C94_08725) | 1885306..1885719 | + | 414 | WP_271451387.1 | PIN domain-containing protein | Toxin |
| M5C94_RS08735 (M5C94_08730) | 1885740..1886102 | + | 363 | WP_271451388.1 | DUF3742 family protein | - |
| M5C94_RS08740 (M5C94_08735) | 1886113..1887633 | - | 1521 | Protein_1731 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| M5C94_RS08745 (M5C94_08740) | 1887788..1889440 | - | 1653 | WP_271451389.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1883073..1884035 | 962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15153.49 Da Isoelectric Point: 6.3220
>T245095 WP_271451387.1 NZ_CP097265:1885306-1885719 [Acidovorax sp. GBBC 712]
MAADKGKVFLDSNVVLYLLSENAAKADSAEALLQRRPVISVQVLNEVTHVCVRKLKMGWSEVGQFLALVRGFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
MAADKGKVFLDSNVVLYLLSENAAKADSAEALLQRRPVISVQVLNEVTHVCVRKLKMGWSEVGQFLALVRGFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|