Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 8337349..8337881 | Replicon | chromosome |
Accession | NZ_CP097263 | ||
Organism | Kutzneria chonburiensis strain SMC256 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M3Q35_RS38880 | Protein ID | WP_273937553.1 |
Coordinates | 8337609..8337881 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M3Q35_RS38875 | Protein ID | WP_273944641.1 |
Coordinates | 8337349..8337612 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3Q35_RS38840 | 8332464..8333645 | - | 1182 | WP_273937548.1 | 4-hydroxyphenylpyruvate dioxygenase | - |
M3Q35_RS38845 | 8333801..8334271 | + | 471 | WP_273944639.1 | Lrp/AsnC family transcriptional regulator | - |
M3Q35_RS38850 | 8334310..8334810 | - | 501 | WP_273937549.1 | transcription elongation factor GreA | - |
M3Q35_RS38855 | 8335022..8335447 | - | 426 | WP_273937550.1 | DUF4307 domain-containing protein | - |
M3Q35_RS38860 | 8335568..8336449 | + | 882 | WP_273937551.1 | mycothiol conjugate amidase Mca | - |
M3Q35_RS38865 | 8336467..8336688 | + | 222 | WP_273944640.1 | hypothetical protein | - |
M3Q35_RS38870 | 8336689..8337297 | + | 609 | WP_273937552.1 | DUF1964 domain-containing protein | - |
M3Q35_RS38875 | 8337349..8337612 | + | 264 | WP_273944641.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M3Q35_RS38880 | 8337609..8337881 | + | 273 | WP_273937553.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3Q35_RS38885 | 8337980..8338327 | + | 348 | WP_273937554.1 | hypothetical protein | - |
M3Q35_RS38890 | 8338306..8339061 | - | 756 | WP_273937555.1 | nucleotidyltransferase domain-containing protein | - |
M3Q35_RS38895 | 8339058..8339729 | - | 672 | WP_273937556.1 | nucleotidyltransferase domain-containing protein | - |
M3Q35_RS38900 | 8339730..8342210 | - | 2481 | WP_273937557.1 | polynucleotide kinase-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10073.72 Da Isoelectric Point: 10.1638
>T245093 WP_273937553.1 NZ_CP097263:8337609-8337881 [Kutzneria chonburiensis]
VSETPYRVVVAPGVRRTLQRLPEKIAAACVEFIVGPLAENPQRLGKPLIGPLEGCPSARRGAYRVVYRISEPERRIDVLR
VDHRADVHHV
VSETPYRVVVAPGVRRTLQRLPEKIAAACVEFIVGPLAENPQRLGKPLIGPLEGCPSARRGAYRVVYRISEPERRIDVLR
VDHRADVHHV
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|