Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 5294539..5295104 | Replicon | chromosome |
| Accession | NZ_CP097263 | ||
| Organism | Kutzneria chonburiensis strain SMC256 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M3Q35_RS23855 | Protein ID | WP_273934503.1 |
| Coordinates | 5294539..5294814 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M3Q35_RS23860 | Protein ID | WP_273934505.1 |
| Coordinates | 5294811..5295104 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3Q35_RS23840 | 5289815..5291059 | + | 1245 | WP_273934500.1 | ribonuclease D | - |
| M3Q35_RS23845 | 5291200..5292390 | + | 1191 | WP_273944433.1 | thiolase family protein | - |
| M3Q35_RS23850 | 5292387..5294492 | + | 2106 | WP_273934501.1 | 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein | - |
| M3Q35_RS23855 | 5294539..5294814 | - | 276 | WP_273934503.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M3Q35_RS23860 | 5294811..5295104 | - | 294 | WP_273934505.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M3Q35_RS23865 | 5295184..5295699 | - | 516 | WP_273934508.1 | hypothetical protein | - |
| M3Q35_RS23870 | 5295757..5296176 | + | 420 | WP_273934510.1 | MarR family transcriptional regulator | - |
| M3Q35_RS23875 | 5296214..5296936 | + | 723 | WP_273934514.1 | DUF72 domain-containing protein | - |
| M3Q35_RS23880 | 5296963..5297757 | + | 795 | WP_273944435.1 | DUF72 domain-containing protein | - |
| M3Q35_RS23885 | 5297805..5298494 | - | 690 | WP_273934516.1 | hypothetical protein | - |
| M3Q35_RS23890 | 5298664..5299023 | + | 360 | WP_273934518.1 | peptidase inhibitor family I36 protein | - |
| M3Q35_RS23895 | 5299043..5299984 | + | 942 | WP_273934520.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10696.09 Da Isoelectric Point: 9.2989
>T245091 WP_273934503.1 NZ_CP097263:c5294814-5294539 [Kutzneria chonburiensis]
MSESYDIAWSPQARRAMAEQVPVHVAMAVYELVTGPLATNPHRIGKQLDPPMDDQWSARRGDYRVLYRIHEDKHQVYVTR
ISHRRDAYRAY
MSESYDIAWSPQARRAMAEQVPVHVAMAVYELVTGPLATNPHRIGKQLDPPMDDQWSARRGDYRVLYRIHEDKHQVYVTR
ISHRRDAYRAY
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|