Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4179377..4180158 | Replicon | chromosome |
| Accession | NZ_CP097262 | ||
| Organism | Salmonella enterica subsp. enterica strain B3-6 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | M3N94_RS20435 | Protein ID | WP_000626100.1 |
| Coordinates | 4179377..4179868 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | M3N94_RS20440 | Protein ID | WP_001110452.1 |
| Coordinates | 4179865..4180158 (-) | Length | 98 a.a. |
Genomic Context
Location: 4174837..4175184 (348 bp)
Type: Others
Protein ID: WP_000887832.1
Type: Others
Protein ID: WP_000887832.1
Location: 4175160..4176863 (1704 bp)
Type: Others
Protein ID: WP_000068885.1
Type: Others
Protein ID: WP_000068885.1
Location: 4176900..4177475 (576 bp)
Type: Others
Protein ID: WP_001188509.1
Type: Others
Protein ID: WP_001188509.1
Location: 4178200..4178277 (78 bp)
Type: Others
Protein ID: Protein_3992
Type: Others
Protein ID: Protein_3992
Location: 4178377..4179129 (753 bp)
Type: Others
Protein ID: WP_000842433.1
Type: Others
Protein ID: WP_000842433.1
Location: 4180475..4180696 (222 bp)
Type: Others
Protein ID: WP_001576552.1
Type: Others
Protein ID: WP_001576552.1
Location: 4180962..4181837 (876 bp)
Type: Others
Protein ID: WP_000921676.1
Type: Others
Protein ID: WP_000921676.1
Location: 4181834..4182121 (288 bp)
Type: Others
Protein ID: WP_001541332.1
Type: Others
Protein ID: WP_001541332.1
Location: 4182421..4182669 (249 bp)
Type: Others
Protein ID: Protein_4000
Type: Others
Protein ID: Protein_4000
Location: 4182781..4182912 (132 bp)
Type: Others
Protein ID: Protein_4001
Type: Others
Protein ID: Protein_4001
Location: 4177746..4177820 (75 bp)
Type: Others
Protein ID: Protein_3991
Type: Others
Protein ID: Protein_3991
Location: 4179377..4179868 (492 bp)
Type: Toxin
Protein ID: WP_000626100.1
Type: Toxin
Protein ID: WP_000626100.1
Location: 4179865..4180158 (294 bp)
Type: Antitoxin
Protein ID: WP_001110452.1
Type: Antitoxin
Protein ID: WP_001110452.1
Location: 4182114..4182422 (309 bp)
Type: Others
Protein ID: WP_072095651.1
Type: Others
Protein ID: WP_072095651.1
Location: 4183206..4184111 (906 bp)
Type: Others
Protein ID: WP_001268200.1
Type: Others
Protein ID: WP_001268200.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N94_RS20400 (4174837) | 4174837..4175184 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
| M3N94_RS20405 (4175160) | 4175160..4176863 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
| M3N94_RS20410 (4176900) | 4176900..4177475 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| M3N94_RS20420 (4177746) | 4177746..4177820 | - | 75 | Protein_3991 | helix-turn-helix domain-containing protein | - |
| M3N94_RS20425 (4178200) | 4178200..4178277 | + | 78 | Protein_3992 | porin family protein | - |
| M3N94_RS20430 (4178377) | 4178377..4179129 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
| M3N94_RS20435 (4179377) | 4179377..4179868 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| M3N94_RS20440 (4179865) | 4179865..4180158 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| M3N94_RS20445 (4180475) | 4180475..4180696 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| M3N94_RS20450 (4180962) | 4180962..4181837 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
| M3N94_RS20455 (4181834) | 4181834..4182121 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
| M3N94_RS20460 (4182114) | 4182114..4182422 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| M3N94_RS20465 (4182421) | 4182421..4182669 | + | 249 | Protein_4000 | Ig-like domain-containing protein | - |
| M3N94_RS20470 (4182781) | 4182781..4182912 | + | 132 | Protein_4001 | hypothetical protein | - |
| M3N94_RS20475 (4183206) | 4183206..4184111 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T245088 WP_000626100.1 NZ_CP097262:c4179868-4179377 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |