Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4031356..4031906 | Replicon | chromosome |
| Accession | NZ_CP097262 | ||
| Organism | Salmonella enterica subsp. enterica strain B3-6 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | M3N94_RS19650 | Protein ID | WP_001199743.1 |
| Coordinates | 4031356..4031664 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | M3N94_RS19655 | Protein ID | WP_001118105.1 |
| Coordinates | 4031667..4031906 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N94_RS19630 (4027930) | 4027930..4028670 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
| M3N94_RS19635 (4028792) | 4028792..4029322 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
| M3N94_RS19640 (4029645) | 4029645..4030778 | + | 1134 | Protein_3841 | IS3 family transposase | - |
| M3N94_RS19645 (4030810) | 4030810..4030950 | - | 141 | Protein_3842 | Arm DNA-binding domain-containing protein | - |
| M3N94_RS19650 (4031356) | 4031356..4031664 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| M3N94_RS19655 (4031667) | 4031667..4031906 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| M3N94_RS19660 (4032015) | 4032015..4032263 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
| M3N94_RS19665 (4032454) | 4032454..4032885 | - | 432 | Protein_3846 | helix-turn-helix domain-containing protein | - |
| M3N94_RS19675 (4033642) | 4033642..4034661 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| M3N94_RS19680 (4034689) | 4034689..4035219 | - | 531 | WP_000896758.1 | gluconokinase | - |
| M3N94_RS19685 (4035436) | 4035436..4036467 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 4029737..4032840 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T245086 WP_001199743.1 NZ_CP097262:c4031664-4031356 [Salmonella enterica subsp. enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |