Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 200177..200937 | Replicon | chromosome |
| Accession | NZ_CP097262 | ||
| Organism | Salmonella enterica subsp. enterica strain B3-6 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A1R2W0C7 |
| Locus tag | M3N94_RS00925 | Protein ID | WP_000533912.1 |
| Coordinates | 200452..200937 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | M7RHS4 |
| Locus tag | M3N94_RS00920 | Protein ID | WP_000965886.1 |
| Coordinates | 200177..200464 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N94_RS00900 (195582) | 195582..196493 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
| M3N94_RS00905 (196503) | 196503..198572 | + | 2070 | WP_001291741.1 | glycine--tRNA ligase subunit beta | - |
| M3N94_RS00910 (198962) | 198962..199360 | + | 399 | Protein_181 | IS3 family transposase | - |
| M3N94_RS00915 (199532) | 199532..199999 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
| M3N94_RS00920 (200177) | 200177..200464 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
| M3N94_RS00925 (200452) | 200452..200937 | + | 486 | WP_000533912.1 | GNAT family N-acetyltransferase | Toxin |
| M3N94_RS00930 (201308) | 201308..201847 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
| M3N94_RS00935 (202021) | 202021..202233 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| M3N94_RS00940 (202521) | 202521..202811 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
| M3N94_RS00945 (203250) | 203250..203960 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
| M3N94_RS00950 (204010) | 204010..204984 | - | 975 | WP_000804678.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| M3N94_RS00955 (205203) | 205203..205865 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17731.46 Da Isoelectric Point: 9.8719
>T245071 WP_000533912.1 NZ_CP097262:200452-200937 [Salmonella enterica subsp. enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1R2W0C7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK8 | |
| AlphaFold DB | A0A3V2JDX2 |