Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 140858..141363 | Replicon | chromosome |
Accession | NZ_CP097256 | ||
Organism | Pseudomonas aeruginosa strain D5 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M4954_RS00645 | Protein ID | WP_003083773.1 |
Coordinates | 140858..141139 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M4954_RS00650 | Protein ID | WP_003083775.1 |
Coordinates | 141136..141363 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4954_RS00620 (M4954_00620) | 136109..137458 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
M4954_RS00625 (M4954_00625) | 137507..138193 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M4954_RS00630 (M4954_00630) | 138294..139028 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
M4954_RS00635 (M4954_00635) | 139208..139618 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
M4954_RS00640 (M4954_00640) | 139650..140558 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
M4954_RS00645 (M4954_00645) | 140858..141139 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M4954_RS00650 (M4954_00650) | 141136..141363 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M4954_RS00655 (M4954_00655) | 141539..142159 | - | 621 | WP_003101226.1 | hypothetical protein | - |
M4954_RS00660 (M4954_00660) | 142260..142760 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
M4954_RS00665 (M4954_00665) | 142833..143174 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
M4954_RS00670 (M4954_00670) | 143256..144683 | - | 1428 | WP_003083784.1 | GABA permease | - |
M4954_RS00675 (M4954_00675) | 144852..146345 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T245059 WP_003083773.1 NZ_CP097256:c141139-140858 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|