Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3780849..3781506 | Replicon | chromosome |
Accession | NZ_CP097255 | ||
Organism | Enterobacter bugandensis strain CMCC(B)45301 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2J7SFN6 |
Locus tag | M1V99_RS18390 | Protein ID | WP_028014322.1 |
Coordinates | 3780849..3781259 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V3PWU7 |
Locus tag | M1V99_RS18395 | Protein ID | WP_010435322.1 |
Coordinates | 3781240..3781506 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1V99_RS18370 (M1V99_18370) | 3776842..3778575 | - | 1734 | WP_041908356.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M1V99_RS18375 (M1V99_18375) | 3778581..3779294 | - | 714 | WP_028014319.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M1V99_RS18380 (M1V99_18380) | 3779323..3780219 | - | 897 | WP_028014320.1 | site-specific tyrosine recombinase XerD | - |
M1V99_RS18385 (M1V99_18385) | 3780321..3780842 | + | 522 | WP_182034214.1 | flavodoxin FldB | - |
M1V99_RS18390 (M1V99_18390) | 3780849..3781259 | - | 411 | WP_028014322.1 | protein YgfX | Toxin |
M1V99_RS18395 (M1V99_18395) | 3781240..3781506 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
M1V99_RS18400 (M1V99_18400) | 3781801..3782781 | + | 981 | WP_028014323.1 | tRNA-modifying protein YgfZ | - |
M1V99_RS18405 (M1V99_18405) | 3782869..3783528 | - | 660 | WP_023331242.1 | hemolysin III family protein | - |
M1V99_RS18410 (M1V99_18410) | 3783794..3784525 | + | 732 | WP_028014325.1 | MurR/RpiR family transcriptional regulator | - |
M1V99_RS18415 (M1V99_18415) | 3784642..3786075 | + | 1434 | WP_028014326.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16024.98 Da Isoelectric Point: 11.2845
>T245057 WP_028014322.1 NZ_CP097255:c3781259-3780849 [Enterobacter bugandensis]
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGVPWMLNAGMMLRLRKVGGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGVPWMLNAGMMLRLRKVGGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J7SFN6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PWU7 |