Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2954717..2955307 | Replicon | chromosome |
| Accession | NZ_CP097255 | ||
| Organism | Enterobacter bugandensis strain CMCC(B)45301 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | M1V99_RS14640 | Protein ID | WP_182035647.1 |
| Coordinates | 2954717..2955049 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A8E1V487 |
| Locus tag | M1V99_RS14645 | Protein ID | WP_041909206.1 |
| Coordinates | 2955050..2955307 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1V99_RS14625 (M1V99_14625) | 2950382..2951725 | + | 1344 | WP_047062999.1 | enolase C-terminal domain-like protein | - |
| M1V99_RS22505 | 2951735..2951866 | + | 132 | WP_255467567.1 | hypothetical protein | - |
| M1V99_RS14630 (M1V99_14630) | 2952028..2953079 | + | 1052 | Protein_2764 | IS3 family transposase | - |
| M1V99_RS14635 (M1V99_14635) | 2953200..2954314 | - | 1115 | Protein_2765 | IS30 family transposase | - |
| M1V99_RS14640 (M1V99_14640) | 2954717..2955049 | - | 333 | WP_182035647.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M1V99_RS14645 (M1V99_14645) | 2955050..2955307 | - | 258 | WP_041909206.1 | antitoxin | Antitoxin |
| M1V99_RS14650 (M1V99_14650) | 2955585..2956544 | - | 960 | WP_182035648.1 | zinc-binding alcohol dehydrogenase family protein | - |
| M1V99_RS14655 (M1V99_14655) | 2956593..2956982 | - | 390 | WP_182035649.1 | RidA family protein | - |
| M1V99_RS14660 (M1V99_14660) | 2957124..2958044 | + | 921 | WP_182035650.1 | LysR family transcriptional regulator | - |
| M1V99_RS14665 (M1V99_14665) | 2958205..2959491 | - | 1287 | WP_249488108.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11841.76 Da Isoelectric Point: 10.2965
>T245055 WP_182035647.1 NZ_CP097255:c2955049-2954717 [Enterobacter bugandensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLVVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTMGVIRCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILN
MDRGEIWLVSLDPIAGHEQSGKRPVLVVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTMGVIRCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILN
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|