Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1103408..1104028 | Replicon | chromosome |
| Accession | NZ_CP097255 | ||
| Organism | Enterobacter bugandensis strain CMCC(B)45301 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | M1V99_RS05790 | Protein ID | WP_008499287.1 |
| Coordinates | 1103408..1103626 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A8E1RNX1 |
| Locus tag | M1V99_RS05795 | Protein ID | WP_028012188.1 |
| Coordinates | 1103654..1104028 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1V99_RS05760 (M1V99_05760) | 1099419..1099679 | + | 261 | WP_194386085.1 | type B 50S ribosomal protein L31 | - |
| M1V99_RS05765 (M1V99_05765) | 1099682..1099822 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| M1V99_RS05770 (M1V99_05770) | 1099819..1100529 | - | 711 | WP_088205223.1 | GNAT family protein | - |
| M1V99_RS05775 (M1V99_05775) | 1100631..1102091 | + | 1461 | WP_194385901.1 | PLP-dependent aminotransferase family protein | - |
| M1V99_RS05780 (M1V99_05780) | 1102063..1102530 | - | 468 | WP_028012186.1 | YlaC family protein | - |
| M1V99_RS05785 (M1V99_05785) | 1102647..1103198 | - | 552 | WP_028012187.1 | maltose O-acetyltransferase | - |
| M1V99_RS05790 (M1V99_05790) | 1103408..1103626 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| M1V99_RS05795 (M1V99_05795) | 1103654..1104028 | - | 375 | WP_028012188.1 | Hha toxicity modulator TomB | Antitoxin |
| M1V99_RS05800 (M1V99_05800) | 1104538..1107684 | - | 3147 | WP_047367620.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M1V99_RS05805 (M1V99_05805) | 1107707..1108900 | - | 1194 | WP_028012190.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T245050 WP_008499287.1 NZ_CP097255:c1103626-1103408 [Enterobacter bugandensis]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14511.30 Da Isoelectric Point: 4.8886
>AT245050 WP_028012188.1 NZ_CP097255:c1104028-1103654 [Enterobacter bugandensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|