Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 152436..153043 | Replicon | chromosome |
| Accession | NZ_CP097255 | ||
| Organism | Enterobacter bugandensis strain CMCC(B)45301 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A2T4Y605 |
| Locus tag | M1V99_RS01300 | Protein ID | WP_041911637.1 |
| Coordinates | 152436..152621 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M1V99_RS01305 | Protein ID | WP_249488262.1 |
| Coordinates | 152636..153043 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1V99_RS01280 (M1V99_01280) | 147818..148702 | - | 885 | WP_249488259.1 | ROK family protein | - |
| M1V99_RS01285 (M1V99_01285) | 148868..150406 | + | 1539 | WP_249488260.1 | aldehyde dehydrogenase AldB | - |
| M1V99_RS01290 (M1V99_01290) | 150403..151368 | - | 966 | WP_249488261.1 | LysR family transcriptional regulator | - |
| M1V99_RS01295 (M1V99_01295) | 151486..152226 | + | 741 | WP_028015056.1 | MipA/OmpV family protein | - |
| M1V99_RS01300 (M1V99_01300) | 152436..152621 | + | 186 | WP_041911637.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M1V99_RS01305 (M1V99_01305) | 152636..153043 | + | 408 | WP_249488262.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M1V99_RS01310 (M1V99_01310) | 153047..154123 | - | 1077 | WP_060572008.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| M1V99_RS01315 (M1V99_01315) | 154330..156279 | - | 1950 | WP_249488263.1 | glycoside hydrolase family 127 protein | - |
| M1V99_RS01320 (M1V99_01320) | 156290..157690 | - | 1401 | WP_249488264.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6852.04 Da Isoelectric Point: 11.2341
>T245049 WP_041911637.1 NZ_CP097255:152436-152621 [Enterobacter bugandensis]
VKSADVITVLIGHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLIGHGWKCVRTKGSHHQFRHPEQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15061.82 Da Isoelectric Point: 4.3191
>AT245049 WP_249488262.1 NZ_CP097255:152636-153043 [Enterobacter bugandensis]
MFYPAYIHSDTDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGNVEVHLENHPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPG
MFYPAYIHSDTDGSASGFFPDVPGCFFAGDSLDDAFQDARDALTAHFEALFEMDEALPLPGNVEVHLENHPDDFTGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|