Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafQ-relB/YafQ-RelB |
| Location | 5855898..5856429 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | X6CWI9 |
| Locus tag | M5D98_RS28595 | Protein ID | WP_023764622.1 |
| Coordinates | 5856157..5856429 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | X6DV70 |
| Locus tag | M5D98_RS28590 | Protein ID | WP_023764621.1 |
| Coordinates | 5855898..5856155 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS28580 (M5D98_28580) | 5852709..5853674 | + | 966 | WP_224687519.1 | sugar-binding transcriptional regulator | - |
| M5D98_RS28585 (M5D98_28585) | 5853758..5855812 | + | 2055 | WP_224687518.1 | bifunctional aldolase/short-chain dehydrogenase | - |
| M5D98_RS28590 (M5D98_28590) | 5855898..5856155 | + | 258 | WP_023764621.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5D98_RS28595 (M5D98_28595) | 5856157..5856429 | + | 273 | WP_023764622.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| M5D98_RS28600 (M5D98_28600) | 5856512..5857564 | - | 1053 | WP_023764623.1 | substrate-binding domain-containing protein | - |
| M5D98_RS28605 (M5D98_28605) | 5857613..5858608 | - | 996 | WP_224687517.1 | ABC transporter permease | - |
| M5D98_RS28610 (M5D98_28610) | 5858691..5860202 | - | 1512 | WP_224687516.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10500.10 Da Isoelectric Point: 9.5341
>T245047 WP_023764622.1 NZ_CP097252:5856157-5856429 [Mesorhizobium opportunistum]
MLTPVRSGQFRRDVKRMEKRGKDLAKLRELLALLVAGQELPAIYKDHPLKGDWKGYRDAHVEPDWLLIYRIADDELRLAR
TGSHSDLFNE
MLTPVRSGQFRRDVKRMEKRGKDLAKLRELLALLVAGQELPAIYKDHPLKGDWKGYRDAHVEPDWLLIYRIADDELRLAR
TGSHSDLFNE
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|