Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
| Location | 5404570..5405041 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M5D98_RS26430 | Protein ID | WP_224685051.1 |
| Coordinates | 5404570..5404836 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | - |
| Locus tag | M5D98_RS26435 | Protein ID | WP_031258550.1 |
| Coordinates | 5404820..5405041 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS26400 (M5D98_26400) | 5399678..5400568 | - | 891 | WP_224685055.1 | YicC/YloC family endoribonuclease | - |
| M5D98_RS26405 (M5D98_26405) | 5400715..5401797 | - | 1083 | WP_224685054.1 | endolytic transglycosylase MltG | - |
| M5D98_RS26410 (M5D98_26410) | 5401796..5402068 | + | 273 | WP_224685053.1 | hypothetical protein | - |
| M5D98_RS26415 (M5D98_26415) | 5402056..5403318 | - | 1263 | WP_013896299.1 | beta-ketoacyl-ACP synthase II | - |
| M5D98_RS26420 (M5D98_26420) | 5403353..5403589 | - | 237 | WP_006203723.1 | acyl carrier protein | - |
| M5D98_RS26425 (M5D98_26425) | 5403801..5404538 | - | 738 | WP_224685052.1 | 3-oxoacyl-[acyl-carrier-protein] reductase | - |
| M5D98_RS26430 (M5D98_26430) | 5404570..5404836 | - | 267 | WP_224685051.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5D98_RS26435 (M5D98_26435) | 5404820..5405041 | - | 222 | WP_031258550.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| M5D98_RS26440 (M5D98_26440) | 5405097..5406035 | - | 939 | WP_224685050.1 | ACP S-malonyltransferase | - |
| M5D98_RS26445 (M5D98_26445) | 5406313..5408241 | + | 1929 | WP_224685049.1 | LTA synthase family protein | - |
| M5D98_RS26450 (M5D98_26450) | 5408709..5409200 | + | 492 | WP_224685048.1 | 30S ribosomal protein S6 | - |
| M5D98_RS26455 (M5D98_26455) | 5409200..5409448 | + | 249 | WP_006203718.1 | 30S ribosomal protein S18 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10293.99 Da Isoelectric Point: 10.1413
>T245046 WP_224685051.1 NZ_CP097252:c5404836-5404570 [Mesorhizobium opportunistum]
VAWTLEYPRSARKFVEKLDPKTRHRIRDFIENRIAVLDNPCEAGKALKGPLATLWRYRVGDYRIICDVQDSRLVVLVVTI
GHRADIYR
VAWTLEYPRSARKFVEKLDPKTRHRIRDFIENRIAVLDNPCEAGKALKGPLATLWRYRVGDYRIICDVQDSRLVVLVVTI
GHRADIYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|