Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3465310..3465971 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | X6DT42 |
| Locus tag | M5D98_RS16835 | Protein ID | WP_023777979.1 |
| Coordinates | 3465534..3465971 (+) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5D98_RS16830 | Protein ID | WP_224686186.1 |
| Coordinates | 3465310..3465537 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS16815 (M5D98_16815) | 3460697..3461731 | + | 1035 | WP_013894591.1 | ABC transporter permease | - |
| M5D98_RS16820 (M5D98_16820) | 3461743..3462900 | + | 1158 | WP_023765202.1 | ABC transporter permease | - |
| M5D98_RS16825 (M5D98_16825) | 3462951..3465155 | + | 2205 | WP_224686187.1 | ABC transporter ATP-binding protein | - |
| M5D98_RS16830 (M5D98_16830) | 3465310..3465537 | + | 228 | WP_224686186.1 | CopG family transcriptional regulator | Antitoxin |
| M5D98_RS16835 (M5D98_16835) | 3465534..3465971 | + | 438 | WP_023777979.1 | DNA-binding protein | Toxin |
| M5D98_RS16840 (M5D98_16840) | 3466060..3466650 | - | 591 | WP_224686185.1 | transglycosylase SLT domain-containing protein | - |
| M5D98_RS16845 (M5D98_16845) | 3466867..3468405 | + | 1539 | WP_224686184.1 | trimethylamine methyltransferase family protein | - |
| M5D98_RS16850 (M5D98_16850) | 3468484..3470910 | + | 2427 | WP_224686183.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15515.73 Da Isoelectric Point: 7.5194
>T245042 WP_023777979.1 NZ_CP097252:3465534-3465971 [Mesorhizobium opportunistum]
VTFLFDVNVLIALIDPAHVAHEDAHRWFQSTGHLSWATCPITENGVIRILSNPKYPNSPGSPAVVAQIVGKLHALSGHQF
WSDDISLVGSSDIDAARILTSAQVTDSYLLGLAKARGGKLATFDRKLSTAAVRGGKPILHLIPSE
VTFLFDVNVLIALIDPAHVAHEDAHRWFQSTGHLSWATCPITENGVIRILSNPKYPNSPGSPAVVAQIVGKLHALSGHQF
WSDDISLVGSSDIDAARILTSAQVTDSYLLGLAKARGGKLATFDRKLSTAAVRGGKPILHLIPSE
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|