Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 3159901..3160496 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M5D98_RS15325 | Protein ID | WP_224690350.1 |
| Coordinates | 3160308..3160496 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5D98_RS15320 | Protein ID | WP_224690351.1 |
| Coordinates | 3159901..3160302 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS15295 (M5D98_15295) | 3155013..3155189 | + | 177 | WP_224690357.1 | hypothetical protein | - |
| M5D98_RS15300 (M5D98_15300) | 3155340..3157256 | + | 1917 | WP_224690356.1 | diguanylate cyclase | - |
| M5D98_RS15305 (M5D98_15305) | 3157270..3158124 | - | 855 | WP_224690354.1 | helix-turn-helix transcriptional regulator | - |
| M5D98_RS15310 (M5D98_15310) | 3158222..3159106 | + | 885 | WP_224690353.1 | SDR family oxidoreductase | - |
| M5D98_RS15315 (M5D98_15315) | 3159117..3159815 | - | 699 | WP_224690352.1 | RibD family protein | - |
| M5D98_RS15320 (M5D98_15320) | 3159901..3160302 | - | 402 | WP_224690351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5D98_RS15325 (M5D98_15325) | 3160308..3160496 | - | 189 | WP_224690350.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5D98_RS15330 (M5D98_15330) | 3160846..3161793 | + | 948 | WP_023767148.1 | substrate-binding domain-containing protein | - |
| M5D98_RS15335 (M5D98_15335) | 3162032..3163627 | + | 1596 | WP_224690552.1 | sugar ABC transporter ATP-binding protein | - |
| M5D98_RS15340 (M5D98_15340) | 3163624..3164637 | + | 1014 | WP_224690551.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7045.15 Da Isoelectric Point: 11.8350
>T245041 WP_224690350.1 NZ_CP097252:c3160496-3160308 [Mesorhizobium opportunistum]
MNSADIIRLLEADGWFEVSRKGSHAQFKHRGKPGRVTVPHPRRDIPIGTLRSIEKQSGLKLR
MNSADIIRLLEADGWFEVSRKGSHAQFKHRGKPGRVTVPHPRRDIPIGTLRSIEKQSGLKLR
Download Length: 189 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14274.15 Da Isoelectric Point: 4.2535
>AT245041 WP_224690351.1 NZ_CP097252:c3160302-3159901 [Mesorhizobium opportunistum]
MKQYIGLIHKDAGSDFGVSFPDFPGVITAGKDLDDARSMAEEALTLHIEGLVEDGDAIPEPSSLEAVMADADNRDGVAIL
VAVKTEARKTVRINVTLPDDVLQRIDAFAEAHGYTRSGFLAKAAEKVMELEMA
MKQYIGLIHKDAGSDFGVSFPDFPGVITAGKDLDDARSMAEEALTLHIEGLVEDGDAIPEPSSLEAVMADADNRDGVAIL
VAVKTEARKTVRINVTLPDDVLQRIDAFAEAHGYTRSGFLAKAAEKVMELEMA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|