Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3146239..3147020 | Replicon | chromosome |
Accession | NZ_CP097252 | ||
Organism | Mesorhizobium opportunistum strain WSM1558 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M5D98_RS15240 | Protein ID | WP_224690369.1 |
Coordinates | 3146239..3146733 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | M5D98_RS15245 | Protein ID | WP_224690367.1 |
Coordinates | 3146730..3147020 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5D98_RS15215 (M5D98_15215) | 3141520..3142308 | - | 789 | WP_023766160.1 | ABC transporter substrate-binding protein | - |
M5D98_RS15220 (M5D98_15220) | 3142420..3143580 | - | 1161 | WP_224690374.1 | saccharopine dehydrogenase family protein | - |
M5D98_RS15225 (M5D98_15225) | 3143577..3144077 | - | 501 | WP_013894264.1 | Lrp/AsnC family transcriptional regulator | - |
M5D98_RS15230 (M5D98_15230) | 3144240..3145112 | - | 873 | WP_224690373.1 | LysR substrate-binding domain-containing protein | - |
M5D98_RS15235 (M5D98_15235) | 3145462..3146211 | + | 750 | WP_224690370.1 | sulfite exporter TauE/SafE family protein | - |
M5D98_RS15240 (M5D98_15240) | 3146239..3146733 | - | 495 | WP_224690369.1 | GNAT family N-acetyltransferase | Toxin |
M5D98_RS15245 (M5D98_15245) | 3146730..3147020 | - | 291 | WP_224690367.1 | DUF1778 domain-containing protein | Antitoxin |
M5D98_RS15250 (M5D98_15250) | 3147119..3147568 | - | 450 | WP_224690366.1 | universal stress protein | - |
M5D98_RS15255 (M5D98_15255) | 3147834..3148415 | + | 582 | WP_224690365.1 | histidine phosphatase family protein | - |
M5D98_RS15260 (M5D98_15260) | 3148692..3149093 | - | 402 | WP_224690364.1 | VOC family protein | - |
M5D98_RS15265 (M5D98_15265) | 3149191..3150234 | - | 1044 | WP_224690363.1 | sigma-70 family RNA polymerase sigma factor | - |
M5D98_RS15270 (M5D98_15270) | 3150292..3151038 | - | 747 | WP_224690362.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17378.96 Da Isoelectric Point: 8.0963
>T245040 WP_224690369.1 NZ_CP097252:c3146733-3146239 [Mesorhizobium opportunistum]
VSLSAPVPLADHHDLNDFSSGIPSLDDWLKKRARANQAGGASRTYVTCIGNRVVGYYAIASGGVRMVETPGRFRRNMPDP
IPVVVLGRLAVDQSHHGQGIGRALVRDAGLRILQAAEILGIRGILVHAISDDARAFYMAVGFEPSPVEPLTLMATLADLG
ASLG
VSLSAPVPLADHHDLNDFSSGIPSLDDWLKKRARANQAGGASRTYVTCIGNRVVGYYAIASGGVRMVETPGRFRRNMPDP
IPVVVLGRLAVDQSHHGQGIGRALVRDAGLRILQAAEILGIRGILVHAISDDARAFYMAVGFEPSPVEPLTLMATLADLG
ASLG
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|