Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PrpT-parD/ParE-RHH |
| Location | 2730888..2731414 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | PrpT | Uniprot ID | F7YH10 |
| Locus tag | M5D98_RS13215 | Protein ID | WP_013893673.1 |
| Coordinates | 2730888..2731181 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | M5D98_RS13220 | Protein ID | WP_224688184.1 |
| Coordinates | 2731178..2731414 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS13190 (M5D98_13190) | 2726774..2727724 | - | 951 | WP_224688180.1 | trypsin-like peptidase domain-containing protein | - |
| M5D98_RS13195 (M5D98_13195) | 2727951..2728823 | + | 873 | WP_224688181.1 | S1C family serine protease | - |
| M5D98_RS13200 (M5D98_13200) | 2728832..2729464 | + | 633 | WP_224688182.1 | helix-turn-helix transcriptional regulator | - |
| M5D98_RS13205 (M5D98_13205) | 2729583..2729846 | - | 264 | WP_023767085.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M5D98_RS13210 (M5D98_13210) | 2730025..2730891 | + | 867 | WP_224688183.1 | NAD(P)-dependent oxidoreductase | - |
| M5D98_RS13215 (M5D98_13215) | 2730888..2731181 | - | 294 | WP_013893673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5D98_RS13220 (M5D98_13220) | 2731178..2731414 | - | 237 | WP_224688184.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| M5D98_RS13225 (M5D98_13225) | 2731876..2733345 | - | 1470 | WP_249491007.1 | OmpA family protein | - |
| M5D98_RS13230 (M5D98_13230) | 2733358..2734101 | + | 744 | WP_249491008.1 | hypothetical protein | - |
| M5D98_RS13235 (M5D98_13235) | 2734379..2734825 | + | 447 | WP_224688218.1 | YcgN family cysteine cluster protein | - |
| M5D98_RS13240 (M5D98_13240) | 2735034..2735405 | + | 372 | WP_224688186.1 | hypothetical protein | - |
| M5D98_RS13245 (M5D98_13245) | 2735610..2736320 | - | 711 | WP_224688187.1 | SIMPL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11353.24 Da Isoelectric Point: 10.6541
>T245039 WP_013893673.1 NZ_CP097252:c2731181-2730888 [Mesorhizobium opportunistum]
MKRTVRFSPKAKADLDQIWDHSLKEWGAERAEAYIRTIRSIINLIDQFPAMAKNAENIRPGLLKYAVGSHVLFLRIADRS
IDVVRILHQRMDYPRHL
MKRTVRFSPKAKADLDQIWDHSLKEWGAERAEAYIRTIRSIINLIDQFPAMAKNAENIRPGLLKYAVGSHVLFLRIADRS
IDVVRILHQRMDYPRHL
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|