Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 482770..483452 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5D98_RS02270 | Protein ID | WP_224689493.1 |
| Coordinates | 483030..483452 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5D98_RS02265 | Protein ID | WP_224689513.1 |
| Coordinates | 482770..483033 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS02240 (M5D98_02240) | 477846..478787 | + | 942 | WP_023765673.1 | sugar ABC transporter substrate-binding protein | - |
| M5D98_RS02245 (M5D98_02245) | 478893..479969 | + | 1077 | WP_023765674.1 | ABC transporter permease | - |
| M5D98_RS02250 (M5D98_02250) | 479972..480754 | + | 783 | WP_013891716.1 | ATP-binding cassette domain-containing protein | - |
| M5D98_RS02255 (M5D98_02255) | 480876..481871 | + | 996 | WP_023776019.1 | inositol 2-dehydrogenase | - |
| M5D98_RS02260 (M5D98_02260) | 481903..482697 | + | 795 | WP_023776020.1 | SDR family oxidoreductase | - |
| M5D98_RS02265 (M5D98_02265) | 482770..483033 | + | 264 | WP_224689513.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5D98_RS02270 (M5D98_02270) | 483030..483452 | + | 423 | WP_224689493.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5D98_RS02275 (M5D98_02275) | 483892..484983 | + | 1092 | WP_023767547.1 | 3-deoxy-7-phosphoheptulonate synthase | - |
| M5D98_RS02280 (M5D98_02280) | 485031..485666 | - | 636 | WP_224689494.1 | LysE family translocator | - |
| M5D98_RS02285 (M5D98_02285) | 485815..486513 | + | 699 | WP_224689495.1 | YafY family protein | - |
| M5D98_RS02290 (M5D98_02290) | 486682..487791 | - | 1110 | WP_249490959.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15672.94 Da Isoelectric Point: 4.5692
>T245037 WP_224689493.1 NZ_CP097252:483030-483452 [Mesorhizobium opportunistum]
VRVLLDTNVLSEVTRPEPDARVLDWLDGLDEDRSFISVVSIAEIRRGVALMDEGRKREALAEWLARDLPQRFEQRVLPVN
EPVALAWGDLMGLAKRRGRGLSSMDGLIAATAIAQQLTLVTRNTKDFEGFGIELFDPWTA
VRVLLDTNVLSEVTRPEPDARVLDWLDGLDEDRSFISVVSIAEIRRGVALMDEGRKREALAEWLARDLPQRFEQRVLPVN
EPVALAWGDLMGLAKRRGRGLSSMDGLIAATAIAQQLTLVTRNTKDFEGFGIELFDPWTA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|